Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JNUCC22_RS11625 Genome accession   NZ_CP076408
Coordinates   2439036..2439209 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. JNUCC-22     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2434036..2444209
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNUCC22_RS11610 (JNUCC22_11610) gcvT 2434849..2435949 (-) 1101 WP_216061742.1 glycine cleavage system aminomethyltransferase GcvT -
  JNUCC22_RS11615 (JNUCC22_11615) - 2436373..2438043 (+) 1671 WP_108655005.1 SNF2-related protein -
  JNUCC22_RS11620 (JNUCC22_11620) - 2438065..2438859 (+) 795 WP_015240204.1 YqhG family protein -
  JNUCC22_RS11625 (JNUCC22_11625) sinI 2439036..2439209 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JNUCC22_RS11630 (JNUCC22_11630) sinR 2439243..2439578 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JNUCC22_RS11635 (JNUCC22_11635) tasA 2439626..2440411 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  JNUCC22_RS11640 (JNUCC22_11640) sipW 2440476..2441060 (-) 585 WP_015240205.1 signal peptidase I SipW -
  JNUCC22_RS11645 (JNUCC22_11645) tapA 2441032..2441703 (-) 672 WP_095352946.1 amyloid fiber anchoring/assembly protein TapA -
  JNUCC22_RS11650 (JNUCC22_11650) - 2441962..2442291 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  JNUCC22_RS11655 (JNUCC22_11655) - 2442332..2442511 (-) 180 WP_003153093.1 YqzE family protein -
  JNUCC22_RS11660 (JNUCC22_11660) comGG 2442568..2442945 (-) 378 WP_216061743.1 competence type IV pilus minor pilin ComGG Machinery gene
  JNUCC22_RS11665 (JNUCC22_11665) comGF 2442946..2443446 (-) 501 WP_252729700.1 competence type IV pilus minor pilin ComGF -
  JNUCC22_RS11670 (JNUCC22_11670) comGE 2443355..2443669 (-) 315 WP_174738084.1 competence type IV pilus minor pilin ComGE Machinery gene
  JNUCC22_RS11675 (JNUCC22_11675) comGD 2443653..2444090 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=575058 JNUCC22_RS11625 WP_003153105.1 2439036..2439209(+) (sinI) [Bacillus sp. JNUCC-22]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=575058 JNUCC22_RS11625 WP_003153105.1 2439036..2439209(+) (sinI) [Bacillus sp. JNUCC-22]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702