Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   JNUCC22_RS11660 Genome accession   NZ_CP076408
Coordinates   2442568..2442945 (-) Length   125 a.a.
NCBI ID   WP_216061743.1    Uniprot ID   -
Organism   Bacillus sp. JNUCC-22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2437568..2447945
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNUCC22_RS11620 (JNUCC22_11620) - 2438065..2438859 (+) 795 WP_015240204.1 YqhG family protein -
  JNUCC22_RS11625 (JNUCC22_11625) sinI 2439036..2439209 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JNUCC22_RS11630 (JNUCC22_11630) sinR 2439243..2439578 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JNUCC22_RS11635 (JNUCC22_11635) tasA 2439626..2440411 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  JNUCC22_RS11640 (JNUCC22_11640) sipW 2440476..2441060 (-) 585 WP_015240205.1 signal peptidase I SipW -
  JNUCC22_RS11645 (JNUCC22_11645) tapA 2441032..2441703 (-) 672 WP_095352946.1 amyloid fiber anchoring/assembly protein TapA -
  JNUCC22_RS11650 (JNUCC22_11650) - 2441962..2442291 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  JNUCC22_RS11655 (JNUCC22_11655) - 2442332..2442511 (-) 180 WP_003153093.1 YqzE family protein -
  JNUCC22_RS11660 (JNUCC22_11660) comGG 2442568..2442945 (-) 378 WP_216061743.1 competence type IV pilus minor pilin ComGG Machinery gene
  JNUCC22_RS11665 (JNUCC22_11665) comGF 2442946..2443446 (-) 501 WP_252729700.1 competence type IV pilus minor pilin ComGF -
  JNUCC22_RS11670 (JNUCC22_11670) comGE 2443355..2443669 (-) 315 WP_174738084.1 competence type IV pilus minor pilin ComGE Machinery gene
  JNUCC22_RS11675 (JNUCC22_11675) comGD 2443653..2444090 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JNUCC22_RS11680 (JNUCC22_11680) comGC 2444080..2444388 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  JNUCC22_RS11685 (JNUCC22_11685) comGB 2444393..2445430 (-) 1038 WP_216061744.1 competence type IV pilus assembly protein ComGB Machinery gene
  JNUCC22_RS11690 (JNUCC22_11690) comGA 2445417..2446487 (-) 1071 WP_216061745.1 competence type IV pilus ATPase ComGA Machinery gene
  JNUCC22_RS11695 (JNUCC22_11695) - 2446684..2447634 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14177.22 Da        Isoelectric Point: 10.2932

>NTDB_id=575060 JNUCC22_RS11660 WP_216061743.1 2442568..2442945(-) (comGG) [Bacillus sp. JNUCC-22]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHITGSDRRETVQVTILAETRTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=575060 JNUCC22_RS11660 WP_216061743.1 2442568..2442945(-) (comGG) [Bacillus sp. JNUCC-22]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCTGGCGGAAACCAGGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50

99.2

0.496