Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG36_RS00705 Genome accession   NZ_CP094099
Coordinates   151132..151257 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe080     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146132..156257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG36_RS00680 (MPG36_00680) - 146194..148416 (+) 2223 WP_245017097.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG36_RS00685 (MPG36_00685) panD 148406..148756 (+) 351 WP_245017098.1 aspartate 1-decarboxylase -
  MPG36_RS00690 (MPG36_00690) - 148767..149060 (+) 294 WP_131128566.1 YbaB/EbfC family nucleoid-associated protein -
  MPG36_RS00695 (MPG36_00695) - 149060..150055 (+) 996 WP_245017419.1 PDZ domain-containing protein -
  MPG36_RS00700 (MPG36_00700) comB6 150061..151116 (+) 1056 WP_245017420.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG36_RS00705 (MPG36_00705) comB7 151132..151257 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG36_RS00710 (MPG36_00710) comB8 151254..151997 (+) 744 WP_245017099.1 virB8 family protein Machinery gene
  MPG36_RS00715 (MPG36_00715) comB9 151997..152962 (+) 966 WP_245017100.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG36_RS00720 (MPG36_00720) comB10 152955..154091 (+) 1137 WP_245017101.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG36_RS00725 (MPG36_00725) - 154161..155573 (+) 1413 WP_245017102.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574825 MPG36_RS00705 WP_001217874.1 151132..151257(+) (comB7) [Helicobacter pylori strain Hpfe080]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574825 MPG36_RS00705 WP_001217874.1 151132..151257(+) (comB7) [Helicobacter pylori strain Hpfe080]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878