Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG32_RS05535 Genome accession   NZ_CP094073
Coordinates   1161994..1162119 (-) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe104     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1156994..1167119
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG32_RS05515 (MPG32_05515) - 1157681..1159093 (-) 1413 WP_245019682.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  MPG32_RS05520 (MPG32_05520) comB10 1159163..1160299 (-) 1137 WP_245019681.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG32_RS05525 (MPG32_05525) comB9 1160292..1161254 (-) 963 WP_245019680.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG32_RS05530 (MPG32_05530) comB8 1161254..1161997 (-) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG32_RS05535 (MPG32_05535) comB7 1161994..1162119 (-) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG32_RS05540 (MPG32_05540) comB6 1162135..1163190 (-) 1056 WP_245036753.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG32_RS05545 (MPG32_05545) - 1163196..1164191 (-) 996 WP_245037541.1 PDZ domain-containing protein -
  MPG32_RS05550 (MPG32_05550) - 1164191..1164484 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG32_RS05555 (MPG32_05555) panD 1164494..1164844 (-) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG32_RS05560 (MPG32_05560) - 1164834..1167056 (-) 2223 WP_245019679.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=574082 MPG32_RS05535 WP_001217867.1 1161994..1162119(-) (comB7) [Helicobacter pylori strain Hpfe104]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574082 MPG32_RS05535 WP_001217867.1 1161994..1162119(-) (comB7) [Helicobacter pylori strain Hpfe104]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACTAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829