Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG58_RS00700 Genome accession   NZ_CP094061
Coordinates   150971..151096 (+) Length   41 a.a.
NCBI ID   WP_245011874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe120     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145971..156096
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG58_RS00675 (MPG58_00675) - 146031..148253 (+) 2223 WP_245011873.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG58_RS00680 (MPG58_00680) panD 148243..148593 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG58_RS00685 (MPG58_00685) - 148604..148897 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG58_RS00690 (MPG58_00690) - 148897..149892 (+) 996 WP_245012209.1 PDZ domain-containing protein -
  MPG58_RS00695 (MPG58_00695) comB6 149900..150955 (+) 1056 WP_245012210.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG58_RS00700 (MPG58_00700) comB7 150971..151096 (+) 126 WP_245011874.1 comB7 lipoprotein Machinery gene
  MPG58_RS00705 (MPG58_00705) comB8 151093..151836 (+) 744 WP_245011875.1 virB8 family protein Machinery gene
  MPG58_RS00710 (MPG58_00710) comB9 151836..152798 (+) 963 WP_245011876.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG58_RS00715 (MPG58_00715) comB10 152791..153927 (+) 1137 WP_245011877.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG58_RS00720 (MPG58_00720) - 153997..155400 (+) 1404 WP_245011878.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4799.81 Da        Isoelectric Point: 8.5446

>NTDB_id=573685 MPG58_RS00700 WP_245011874.1 150971..151096(+) (comB7) [Helicobacter pylori strain Hpfe120]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYEDRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573685 MPG58_RS00700 WP_245011874.1 150971..151096(+) (comB7) [Helicobacter pylori strain Hpfe120]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTGTATGAAGACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854