Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   KM403_RS18930 Genome accession   NZ_CP076163
Coordinates   3643954..3644733 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain BUL 14     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3609632..3683557 3643954..3644733 within 0


Gene organization within MGE regions


Location: 3609632..3683557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM403_RS18780 (KM403_18785) - 3609976..3611646 (-) 1671 WP_000823085.1 ribonuclease J -
  KM403_RS18785 (KM403_18790) dapA 3612412..3613290 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  KM403_RS18790 (KM403_18795) dapG 3613302..3614534 (-) 1233 WP_000692470.1 aspartate kinase -
  KM403_RS18795 (KM403_18800) asd 3614558..3615604 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  KM403_RS18800 (KM403_18805) dpaB 3615755..3616354 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  KM403_RS18805 (KM403_18810) dpaA 3616351..3617253 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  KM403_RS18810 (KM403_18815) - 3617528..3617779 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  KM403_RS18815 (KM403_18820) - 3617906..3619147 (-) 1242 WP_000592993.1 pitrilysin family protein -
  KM403_RS18820 (KM403_18825) - 3619234..3620133 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  KM403_RS18825 (KM403_18830) pnp 3620285..3622423 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  KM403_RS18830 (KM403_18835) rpsO 3622584..3622853 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  KM403_RS18835 (KM403_18840) ribF 3622954..3623925 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  KM403_RS18840 (KM403_18845) truB 3623969..3624892 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  KM403_RS18845 (KM403_18850) rbfA 3624979..3625335 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  KM403_RS18850 (KM403_18855) - 3625351..3625632 (-) 282 WP_000582364.1 DUF503 family protein -
  KM403_RS18855 (KM403_18860) infB 3625629..3627689 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  KM403_RS18860 (KM403_18865) - 3627694..3628005 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  KM403_RS18865 (KM403_18870) - 3628006..3628278 (-) 273 WP_000071128.1 YlxR family protein -
  KM403_RS18870 (KM403_18875) nusA 3628290..3629396 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  KM403_RS18875 (KM403_18880) rimP 3629414..3629884 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  KM403_RS18880 (KM403_18885) - 3630217..3634518 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  KM403_RS18885 (KM403_18890) - 3634643..3636343 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  KM403_RS18890 (KM403_18895) rseP 3636453..3637709 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  KM403_RS18895 (KM403_18900) dxr 3637726..3638868 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  KM403_RS18900 (KM403_18905) cdsA 3638892..3639683 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  KM403_RS18905 (KM403_18910) uppS 3639701..3640477 (-) 777 WP_000971303.1 isoprenyl transferase -
  KM403_RS18910 (KM403_18915) frr 3640563..3641120 (-) 558 WP_000531503.1 ribosome recycling factor -
  KM403_RS18915 (KM403_18920) pyrH 3641123..3641845 (-) 723 WP_000042663.1 UMP kinase -
  KM403_RS18920 (KM403_18925) tsf 3641912..3642799 (-) 888 WP_001018581.1 translation elongation factor Ts -
  KM403_RS18925 (KM403_18930) rpsB 3642903..3643604 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  KM403_RS18930 (KM403_18935) codY 3643954..3644733 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  KM403_RS18935 (KM403_18940) hslU 3644811..3646202 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  KM403_RS18940 (KM403_18945) hslV 3646225..3646767 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  KM403_RS18945 (KM403_18950) xerC 3646810..3647709 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  KM403_RS18950 (KM403_18955) trmFO 3647775..3649079 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KM403_RS18955 (KM403_18960) topA 3649130..3651208 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  KM403_RS18960 (KM403_18965) dprA 3651353..3652221 (-) 869 Protein_3702 DNA-processing protein DprA -
  KM403_RS18965 (KM403_18970) sucD 3652309..3653211 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  KM403_RS18970 (KM403_18975) sucC 3653232..3654392 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  KM403_RS18975 (KM403_18980) rnhB 3654586..3655359 (-) 774 WP_017651024.1 ribonuclease HII -
  KM403_RS18980 (KM403_18985) ylqF 3655411..3656301 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  KM403_RS18985 (KM403_18990) lepB 3656322..3656873 (-) 552 WP_000711857.1 signal peptidase I -
  KM403_RS18990 (KM403_18995) rplS 3656975..3657319 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  KM403_RS18995 (KM403_19000) trmD 3657466..3658200 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KM403_RS19000 (KM403_19005) rimM 3658200..3658715 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  KM403_RS19005 (KM403_19010) - 3658836..3659063 (-) 228 WP_000737398.1 KH domain-containing protein -
  KM403_RS19010 (KM403_19015) rpsP 3659078..3659350 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  KM403_RS19015 (KM403_19020) ffh 3659451..3660800 (-) 1350 WP_000863456.1 signal recognition particle protein -
  KM403_RS19020 (KM403_19025) - 3660813..3661145 (-) 333 WP_000891062.1 putative DNA-binding protein -
  KM403_RS19025 (KM403_19030) ftsY 3661280..3662269 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  KM403_RS19030 (KM403_19035) smc 3662285..3665854 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  KM403_RS19035 (KM403_19040) rncS 3666001..3666738 (-) 738 WP_017651025.1 ribonuclease III -
  KM403_RS19040 (KM403_19045) acpP 3666797..3667030 (-) 234 WP_000786062.1 acyl carrier protein -
  KM403_RS19045 (KM403_19050) fabG 3667100..3667840 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KM403_RS19050 (KM403_19055) fabD 3667840..3668784 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  KM403_RS19055 (KM403_19060) plsX 3668799..3669791 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  KM403_RS19060 (KM403_19065) fapR 3669788..3670381 (-) 594 WP_000747352.1 transcription factor FapR -
  KM403_RS19065 (KM403_19070) recG 3670470..3672518 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  KM403_RS19070 (KM403_19075) - 3672808..3674484 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  KM403_RS19075 (KM403_19080) - 3674507..3674869 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  KM403_RS19080 (KM403_19085) rpmB 3675248..3675436 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  KM403_RS19085 (KM403_19090) spoVM 3675509..3675589 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  KM403_RS19090 (KM403_19095) - 3675656..3676336 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  KM403_RS19095 (KM403_19100) rpe 3676436..3677080 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  KM403_RS19100 (KM403_19105) rsgA 3677083..3677964 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  KM403_RS19105 (KM403_19110) prkC 3678233..3680206 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  KM403_RS19110 (KM403_19115) - 3680215..3680967 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  KM403_RS19115 (KM403_19120) rlmN 3680972..3682060 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  KM403_RS19120 (KM403_19125) rsmB 3682065..3683399 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=572776 KM403_RS18930 WP_000421288.1 3643954..3644733(-) (codY) [Bacillus anthracis strain BUL 14]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=572776 KM403_RS18930 WP_000421288.1 3643954..3644733(-) (codY) [Bacillus anthracis strain BUL 14]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459