Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KH238_RS00265 Genome accession   NZ_CP076045
Coordinates   77173..77292 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain VCN56     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 72173..82292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH238_RS00250 (KH238_00250) - 73785..74468 (+) 684 WP_007410267.1 response regulator transcription factor -
  KH238_RS00255 (KH238_00255) - 74455..75888 (+) 1434 WP_020955322.1 ATP-binding protein -
  KH238_RS00260 (KH238_00260) rapC 76041..77189 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  KH238_RS00265 (KH238_00265) phrC 77173..77292 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KH238_RS00270 (KH238_00270) - 77442..77537 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  KH238_RS00275 (KH238_00275) - 77632..78996 (-) 1365 WP_032866947.1 aspartate kinase -
  KH238_RS00280 (KH238_00280) ceuB 79410..80363 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  KH238_RS00285 (KH238_00285) - 80353..81300 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  KH238_RS00290 (KH238_00290) - 81294..82052 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=571581 KH238_RS00265 WP_003156334.1 77173..77292(+) (phrC) [Bacillus velezensis strain VCN56]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=571581 KH238_RS00265 WP_003156334.1 77173..77292(+) (phrC) [Bacillus velezensis strain VCN56]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718