Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MM522_RS13770 Genome accession   NZ_CP093067
Coordinates   2657586..2657726 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ATC-3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2652586..2662726
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MM522_RS13745 (MM522_13745) yuxO 2652862..2653242 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MM522_RS13750 (MM522_13750) comA 2653261..2653905 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MM522_RS13755 (MM522_13755) comP 2653986..2656298 (-) 2313 WP_047183111.1 histidine kinase Regulator
  MM522_RS13760 (MM522_13760) comX 2656314..2656535 (-) 222 WP_014114983.1 competence pheromone ComX -
  MM522_RS13765 (MM522_13765) comQ 2656532..2657401 (-) 870 WP_161476745.1 polyprenyl synthetase family protein Regulator
  MM522_RS13770 (MM522_13770) degQ 2657586..2657726 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MM522_RS13775 (MM522_13775) - 2657948..2658073 (+) 126 WP_003228793.1 hypothetical protein -
  MM522_RS13780 (MM522_13780) - 2658187..2658555 (+) 369 WP_003243784.1 hypothetical protein -
  MM522_RS13785 (MM522_13785) pdeH 2658531..2659760 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  MM522_RS13790 (MM522_13790) pncB 2659897..2661369 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MM522_RS13795 (MM522_13795) pncA 2661385..2661936 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  MM522_RS13800 (MM522_13800) yueI 2662033..2662431 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=570455 MM522_RS13770 WP_003220708.1 2657586..2657726(-) (degQ) [Bacillus subtilis strain ATC-3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=570455 MM522_RS13770 WP_003220708.1 2657586..2657726(-) (degQ) [Bacillus subtilis strain ATC-3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1