Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KHS93_RS15095 Genome accession   NZ_CP075547
Coordinates   3072014..3072154 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain SN16-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3067014..3077154
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHS93_RS15070 (KHS93_15070) - 3067311..3067694 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  KHS93_RS15075 (KHS93_15075) comA 3067716..3068360 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KHS93_RS15080 (KHS93_15080) - 3068441..3070744 (-) 2304 Protein_2928 histidine kinase -
  KHS93_RS15085 (KHS93_15085) comX 3070764..3070943 (-) 180 WP_306383677.1 competence pheromone ComX -
  KHS93_RS15090 (KHS93_15090) comQ 3070897..3071883 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  KHS93_RS15095 (KHS93_15095) degQ 3072014..3072154 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KHS93_RS15100 (KHS93_15100) - 3072620..3072961 (+) 342 WP_003152040.1 hypothetical protein -
  KHS93_RS15105 (KHS93_15105) - 3072968..3074188 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  KHS93_RS15110 (KHS93_15110) - 3074318..3075784 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KHS93_RS15115 (KHS93_15115) - 3075802..3076353 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KHS93_RS15120 (KHS93_15120) - 3076450..3076848 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=569480 KHS93_RS15095 WP_003152043.1 3072014..3072154(-) (degQ) [Bacillus amyloliquefaciens strain SN16-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=569480 KHS93_RS15095 WP_003152043.1 3072014..3072154(-) (degQ) [Bacillus amyloliquefaciens strain SN16-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891