Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KHS93_RS11845 Genome accession   NZ_CP075547
Coordinates   2471444..2471821 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SN16-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2466444..2476821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHS93_RS11805 (KHS93_11805) - 2466943..2467737 (+) 795 WP_069473503.1 YqhG family protein -
  KHS93_RS11810 (KHS93_11810) sinI 2467914..2468087 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KHS93_RS11815 (KHS93_11815) sinR 2468121..2468456 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHS93_RS11820 (KHS93_11820) - 2468504..2469289 (-) 786 WP_003153102.1 TasA family protein -
  KHS93_RS11825 (KHS93_11825) - 2469353..2469937 (-) 585 WP_003153100.1 signal peptidase I -
  KHS93_RS11830 (KHS93_11830) tapA 2469909..2470580 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  KHS93_RS11835 (KHS93_11835) - 2470839..2471168 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KHS93_RS11840 (KHS93_11840) - 2471208..2471387 (-) 180 WP_003153093.1 YqzE family protein -
  KHS93_RS11845 (KHS93_11845) comGG 2471444..2471821 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHS93_RS11850 (KHS93_11850) comGF 2471822..2472217 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  KHS93_RS11855 (KHS93_11855) comGE 2472231..2472545 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  KHS93_RS11860 (KHS93_11860) comGD 2472529..2472966 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  KHS93_RS11865 (KHS93_11865) comGC 2472956..2473264 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KHS93_RS11870 (KHS93_11870) comGB 2473269..2474306 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  KHS93_RS11875 (KHS93_11875) comGA 2474293..2475363 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KHS93_RS11880 (KHS93_11880) - 2475555..2476505 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=569461 KHS93_RS11845 WP_003153092.1 2471444..2471821(-) (comGG) [Bacillus amyloliquefaciens strain SN16-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=569461 KHS93_RS11845 WP_003153092.1 2471444..2471821(-) (comGG) [Bacillus amyloliquefaciens strain SN16-1]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512