Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KHS93_RS11810 | Genome accession | NZ_CP075547 |
| Coordinates | 2467914..2468087 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain SN16-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2462914..2473087
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHS93_RS11795 (KHS93_11795) | gcvT | 2463732..2464832 (-) | 1101 | WP_069473502.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KHS93_RS11800 (KHS93_11800) | - | 2465255..2466925 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| KHS93_RS11805 (KHS93_11805) | - | 2466943..2467737 (+) | 795 | WP_069473503.1 | YqhG family protein | - |
| KHS93_RS11810 (KHS93_11810) | sinI | 2467914..2468087 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| KHS93_RS11815 (KHS93_11815) | sinR | 2468121..2468456 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KHS93_RS11820 (KHS93_11820) | - | 2468504..2469289 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| KHS93_RS11825 (KHS93_11825) | - | 2469353..2469937 (-) | 585 | WP_003153100.1 | signal peptidase I | - |
| KHS93_RS11830 (KHS93_11830) | tapA | 2469909..2470580 (-) | 672 | WP_046341384.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KHS93_RS11835 (KHS93_11835) | - | 2470839..2471168 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| KHS93_RS11840 (KHS93_11840) | - | 2471208..2471387 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KHS93_RS11845 (KHS93_11845) | comGG | 2471444..2471821 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KHS93_RS11850 (KHS93_11850) | comGF | 2471822..2472217 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| KHS93_RS11855 (KHS93_11855) | comGE | 2472231..2472545 (-) | 315 | WP_046341385.1 | competence type IV pilus minor pilin ComGE | - |
| KHS93_RS11860 (KHS93_11860) | comGD | 2472529..2472966 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=569459 KHS93_RS11810 WP_003153105.1 2467914..2468087(+) (sinI) [Bacillus amyloliquefaciens strain SN16-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=569459 KHS93_RS11810 WP_003153105.1 2467914..2468087(+) (sinI) [Bacillus amyloliquefaciens strain SN16-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |