Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Machinery gene |
| Locus tag | KI613_RS13165 | Genome accession | NZ_CP075190 |
| Coordinates | 2720110..2720412 (-) | Length | 100 a.a. |
| NCBI ID | WP_226400197.1 | Uniprot ID | - |
| Organism | Ferribacterium limneticum strain 76 | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2720552..2751160 | 2720110..2720412 | flank | 140 |
Gene organization within MGE regions
Location: 2720110..2751160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI613_RS13165 (KI613_13105) | comA | 2720110..2720412 (-) | 303 | WP_226400197.1 | ComEC/Rec2 family competence protein | Machinery gene |
| KI613_RS13170 (KI613_13110) | - | 2720471..2721475 (+) | 1005 | WP_226400199.1 | hypothetical protein | - |
| KI613_RS13175 (KI613_13115) | - | 2721646..2723739 (+) | 2094 | WP_226400200.1 | ATP-binding protein | - |
| KI613_RS13180 (KI613_13120) | - | 2723736..2725175 (+) | 1440 | WP_226400201.1 | DNA cytosine methyltransferase | - |
| KI613_RS13185 (KI613_13125) | - | 2725183..2725620 (-) | 438 | WP_226400202.1 | very short patch repair endonuclease | - |
| KI613_RS13190 (KI613_13130) | - | 2725670..2727781 (-) | 2112 | WP_226400203.1 | ATP-binding protein | - |
| KI613_RS13195 (KI613_13135) | - | 2727955..2728614 (-) | 660 | WP_226400204.1 | hypothetical protein | - |
| KI613_RS13200 (KI613_13140) | - | 2729095..2731746 (+) | 2652 | WP_226400205.1 | DDE-type integrase/transposase/recombinase | - |
| KI613_RS13205 (KI613_13145) | - | 2731748..2732902 (+) | 1155 | WP_226400206.1 | AAA family ATPase | - |
| KI613_RS13210 (KI613_13150) | - | 2732889..2734289 (+) | 1401 | WP_226400207.1 | TniQ family protein | - |
| KI613_RS13215 (KI613_13155) | - | 2734487..2734714 (-) | 228 | WP_226400208.1 | hypothetical protein | - |
| KI613_RS13220 (KI613_13160) | - | 2734726..2735349 (-) | 624 | WP_226400209.1 | hypothetical protein | - |
| KI613_RS13225 (KI613_13165) | - | 2735502..2735744 (+) | 243 | WP_226400210.1 | MbcA/ParS/Xre antitoxin family protein | - |
| KI613_RS21235 | - | 2735957..2736088 (-) | 132 | WP_264181434.1 | hypothetical protein | - |
| KI613_RS13230 (KI613_13170) | - | 2736410..2736826 (+) | 417 | WP_226400211.1 | hypothetical protein | - |
| KI613_RS13235 (KI613_13175) | - | 2737328..2737609 (-) | 282 | WP_226400213.1 | integration host factor subunit beta | - |
| KI613_RS13240 (KI613_13180) | - | 2737829..2741185 (-) | 3357 | WP_226400215.1 | EAL domain-containing protein | - |
| KI613_RS13245 (KI613_13185) | - | 2741858..2744491 (+) | 2634 | WP_226400217.1 | EAL domain-containing protein | - |
| KI613_RS13250 (KI613_13190) | - | 2745335..2746243 (+) | 909 | WP_226400219.1 | YafY family protein | - |
| KI613_RS13255 (KI613_13195) | - | 2746297..2746572 (+) | 276 | WP_226400221.1 | multiubiquitin domain-containing protein | - |
| KI613_RS13260 (KI613_13200) | - | 2746573..2746971 (+) | 399 | WP_226400223.1 | E2/UBC family protein | - |
| KI613_RS13265 (KI613_13205) | - | 2746968..2748305 (+) | 1338 | WP_226400225.1 | ThiF family adenylyltransferase | - |
| KI613_RS13270 (KI613_13210) | - | 2748307..2749992 (+) | 1686 | WP_226400227.1 | hypothetical protein | - |
| KI613_RS21415 | - | 2750001..2750519 (+) | 519 | WP_226400229.1 | DUF6527 family protein | - |
| KI613_RS21420 | - | 2750573..2751160 (-) | 588 | WP_226400231.1 | DUF6527 family protein | - |
Sequence
Protein
Download Length: 100 a.a. Molecular weight: 11211.77 Da Isoelectric Point: 10.6125
>NTDB_id=568555 KI613_RS13165 WP_226400197.1 2720110..2720412(-) (comA) [Ferribacterium limneticum strain 76]
MLQRYPDGLAADILLMPHHGSKTSSTPVFLQAVGAAETVIPVGYRNRFGHPKSEVLARYEAMGANIWRTDRDGAVRIRLG
EGAVALSGWRTEHRRYWHGR
MLQRYPDGLAADILLMPHHGSKTSSTPVFLQAVGAAETVIPVGYRNRFGHPKSEVLARYEAMGANIWRTDRDGAVRIRLG
EGAVALSGWRTEHRRYWHGR
Nucleotide
Download Length: 303 bp
>NTDB_id=568555 KI613_RS13165 WP_226400197.1 2720110..2720412(-) (comA) [Ferribacterium limneticum strain 76]
TTGCTCCAGCGCTATCCGGATGGGTTGGCGGCCGATATCCTGCTCATGCCGCACCATGGTTCAAAGACCTCATCGACGCC
GGTTTTCCTGCAGGCGGTCGGCGCAGCCGAAACGGTTATTCCGGTCGGCTATCGCAACCGTTTCGGTCATCCAAAGAGCG
AAGTGCTGGCGCGCTATGAGGCAATGGGTGCAAACATCTGGCGAACCGACCGCGATGGCGCCGTGCGCATCCGGCTGGGT
GAGGGCGCTGTTGCCTTGTCAGGATGGCGAACTGAACATCGCCGGTATTGGCATGGCCGGTGA
TTGCTCCAGCGCTATCCGGATGGGTTGGCGGCCGATATCCTGCTCATGCCGCACCATGGTTCAAAGACCTCATCGACGCC
GGTTTTCCTGCAGGCGGTCGGCGCAGCCGAAACGGTTATTCCGGTCGGCTATCGCAACCGTTTCGGTCATCCAAAGAGCG
AAGTGCTGGCGCGCTATGAGGCAATGGGTGCAAACATCTGGCGAACCGACCGCGATGGCGCCGTGCGCATCCGGCTGGGT
GAGGGCGCTGTTGCCTTGTCAGGATGGCGAACTGAACATCGCCGGTATTGGCATGGCCGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Ralstonia pseudosolanacearum GMI1000 |
52.174 |
92 |
0.48 |
| comA | Neisseria gonorrhoeae MS11 |
37 |
100 |
0.37 |