Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | MK616_RS15250 | Genome accession | NZ_CP092778 |
| Coordinates | 3097249..3097389 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain WF2020 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3092249..3102389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MK616_RS15225 (MK616_15225) | - | 3092589..3092972 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| MK616_RS15230 (MK616_15230) | comA | 3092994..3093638 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| MK616_RS15235 (MK616_15235) | comP | 3093719..3096010 (-) | 2292 | WP_100261980.1 | histidine kinase | Regulator |
| MK616_RS15240 (MK616_15240) | comX | 3096022..3096186 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| MK616_RS15245 (MK616_15245) | comQ | 3096186..3097097 (-) | 912 | WP_420868259.1 | polyprenyl synthetase family protein | Regulator |
| MK616_RS15250 (MK616_15250) | degQ | 3097249..3097389 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| MK616_RS15255 (MK616_15255) | - | 3097855..3098196 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| MK616_RS15260 (MK616_15260) | - | 3098203..3099426 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| MK616_RS15265 (MK616_15265) | - | 3099556..3101022 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| MK616_RS15270 (MK616_15270) | - | 3101040..3101591 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| MK616_RS15275 (MK616_15275) | - | 3101688..3102086 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=568285 MK616_RS15250 WP_003152043.1 3097249..3097389(-) (degQ) [Bacillus amyloliquefaciens strain WF2020]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=568285 MK616_RS15250 WP_003152043.1 3097249..3097389(-) (degQ) [Bacillus amyloliquefaciens strain WF2020]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |