Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MK616_RS15250 Genome accession   NZ_CP092778
Coordinates   3097249..3097389 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain WF2020     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3092249..3102389
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK616_RS15225 (MK616_15225) - 3092589..3092972 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  MK616_RS15230 (MK616_15230) comA 3092994..3093638 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  MK616_RS15235 (MK616_15235) comP 3093719..3096010 (-) 2292 WP_100261980.1 histidine kinase Regulator
  MK616_RS15240 (MK616_15240) comX 3096022..3096186 (-) 165 WP_007613432.1 competence pheromone ComX -
  MK616_RS15245 (MK616_15245) comQ 3096186..3097097 (-) 912 WP_420868259.1 polyprenyl synthetase family protein Regulator
  MK616_RS15250 (MK616_15250) degQ 3097249..3097389 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MK616_RS15255 (MK616_15255) - 3097855..3098196 (+) 342 WP_014418765.1 hypothetical protein -
  MK616_RS15260 (MK616_15260) - 3098203..3099426 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  MK616_RS15265 (MK616_15265) - 3099556..3101022 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  MK616_RS15270 (MK616_15270) - 3101040..3101591 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  MK616_RS15275 (MK616_15275) - 3101688..3102086 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=568285 MK616_RS15250 WP_003152043.1 3097249..3097389(-) (degQ) [Bacillus amyloliquefaciens strain WF2020]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=568285 MK616_RS15250 WP_003152043.1 3097249..3097389(-) (degQ) [Bacillus amyloliquefaciens strain WF2020]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891