Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   KIP81_RS08835 Genome accession   NZ_CP075172
Coordinates   1778365..1778514 (+) Length   49 a.a.
NCBI ID   WP_200769438.1    Uniprot ID   -
Organism   Streptococcus equinus strain SheepZ001     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1773365..1783514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIP81_RS08805 (KIP81_08795) comD/comD3 1774102..1775118 (-) 1017 WP_243602838.1 GHKL domain-containing protein Regulator
  KIP81_RS08810 (KIP81_08800) comD/comD3 1775487..1776866 (-) 1380 WP_243602839.1 GHKL domain-containing protein Regulator
  KIP81_RS08815 (KIP81_08805) - 1776873..1777070 (-) 198 WP_243602840.1 hypothetical protein -
  KIP81_RS08820 (KIP81_08810) - 1777232..1777525 (-) 294 WP_074630224.1 bacteriocin immunity protein -
  KIP81_RS08825 (KIP81_08815) - 1777556..1777861 (-) 306 WP_134775646.1 bacteriocin immunity protein -
  KIP81_RS08830 (KIP81_08820) - 1777881..1778177 (-) 297 WP_081341079.1 DUF3884 family protein -
  KIP81_RS08835 (KIP81_08825) comC/comC1 1778365..1778514 (+) 150 WP_200769438.1 hypothetical protein Regulator
  KIP81_RS08840 (KIP81_08830) - 1778531..1779853 (-) 1323 WP_243602841.1 GHKL domain-containing protein -
  KIP81_RS08845 (KIP81_08835) comE/comE1 1779858..1780589 (-) 732 WP_243602842.1 response regulator transcription factor Regulator
  KIP81_RS08850 (KIP81_08840) - 1781545..1781853 (-) 309 WP_074567284.1 bacteriocin immunity protein -
  KIP81_RS08855 (KIP81_08845) - 1781853..1782104 (-) 252 Protein_1682 garvicin Q family class II bacteriocin -
  KIP81_RS08860 (KIP81_08850) - 1782410..1782583 (+) 174 WP_142349959.1 bacteriocin -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5621.47 Da        Isoelectric Point: 7.0083

>NTDB_id=568270 KIP81_RS08835 WP_200769438.1 1778365..1778514(+) (comC/comC1) [Streptococcus equinus strain SheepZ001]
MNEWKLSELNSVKNLTEADLEKTVGGDTTLLTGVFGWLKKFQEKPQKHM

Nucleotide


Download         Length: 150 bp        

>NTDB_id=568270 KIP81_RS08835 WP_200769438.1 1778365..1778514(+) (comC/comC1) [Streptococcus equinus strain SheepZ001]
ATGAATGAATGGAAATTATCAGAATTAAACTCTGTTAAGAATTTAACAGAAGCTGATTTGGAGAAGACCGTTGGAGGAGA
TACCACTCTACTCACTGGTGTTTTTGGTTGGTTGAAAAAATTTCAAGAAAAGCCTCAGAAACATATGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

61.364

89.796

0.551