Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KH263_RS11895 | Genome accession | NZ_CP074685 |
| Coordinates | 2510486..2510659 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain VTX9 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2505486..2515659
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KH263_RS11880 (KH263_11880) | gcvT | 2506303..2507403 (-) | 1101 | WP_213403482.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KH263_RS11885 (KH263_11885) | - | 2507827..2509497 (+) | 1671 | WP_213403484.1 | SNF2-related protein | - |
| KH263_RS11890 (KH263_11890) | - | 2509515..2510309 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| KH263_RS11895 (KH263_11895) | sinI | 2510486..2510659 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| KH263_RS11900 (KH263_11900) | sinR | 2510693..2511028 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KH263_RS11905 (KH263_11905) | - | 2511076..2511861 (-) | 786 | WP_015388008.1 | TasA family protein | - |
| KH263_RS11910 (KH263_11910) | - | 2511925..2512509 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| KH263_RS11915 (KH263_11915) | tapA | 2512481..2513152 (-) | 672 | WP_165625718.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KH263_RS11920 (KH263_11920) | - | 2513411..2513740 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| KH263_RS11925 (KH263_11925) | - | 2513780..2513959 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KH263_RS11930 (KH263_11930) | comGG | 2514016..2514393 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KH263_RS11935 (KH263_11935) | comGF | 2514394..2514789 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| KH263_RS11940 (KH263_11940) | comGE | 2514803..2515117 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| KH263_RS11945 (KH263_11945) | comGD | 2515101..2515538 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=565730 KH263_RS11895 WP_003153105.1 2510486..2510659(+) (sinI) [Bacillus velezensis strain VTX9]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=565730 KH263_RS11895 WP_003153105.1 2510486..2510659(+) (sinI) [Bacillus velezensis strain VTX9]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |