Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KH263_RS11895 Genome accession   NZ_CP074685
Coordinates   2510486..2510659 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain VTX9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2505486..2515659
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH263_RS11880 (KH263_11880) gcvT 2506303..2507403 (-) 1101 WP_213403482.1 glycine cleavage system aminomethyltransferase GcvT -
  KH263_RS11885 (KH263_11885) - 2507827..2509497 (+) 1671 WP_213403484.1 SNF2-related protein -
  KH263_RS11890 (KH263_11890) - 2509515..2510309 (+) 795 WP_003153106.1 YqhG family protein -
  KH263_RS11895 (KH263_11895) sinI 2510486..2510659 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KH263_RS11900 (KH263_11900) sinR 2510693..2511028 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH263_RS11905 (KH263_11905) - 2511076..2511861 (-) 786 WP_015388008.1 TasA family protein -
  KH263_RS11910 (KH263_11910) - 2511925..2512509 (-) 585 WP_012117977.1 signal peptidase I -
  KH263_RS11915 (KH263_11915) tapA 2512481..2513152 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  KH263_RS11920 (KH263_11920) - 2513411..2513740 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KH263_RS11925 (KH263_11925) - 2513780..2513959 (-) 180 WP_003153093.1 YqzE family protein -
  KH263_RS11930 (KH263_11930) comGG 2514016..2514393 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH263_RS11935 (KH263_11935) comGF 2514394..2514789 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  KH263_RS11940 (KH263_11940) comGE 2514803..2515117 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KH263_RS11945 (KH263_11945) comGD 2515101..2515538 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=565730 KH263_RS11895 WP_003153105.1 2510486..2510659(+) (sinI) [Bacillus velezensis strain VTX9]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=565730 KH263_RS11895 WP_003153105.1 2510486..2510659(+) (sinI) [Bacillus velezensis strain VTX9]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702