Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KIH94_RS15665 Genome accession   NZ_CP074571
Coordinates   3037717..3037857 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BYS2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3032717..3042857
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIH94_RS15640 (KIH94_15640) yuxO 3033060..3033440 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  KIH94_RS15645 (KIH94_15645) comA 3033458..3034102 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KIH94_RS15650 (KIH94_15650) comP 3034183..3036483 (-) 2301 WP_213417620.1 histidine kinase Regulator
  KIH94_RS15655 (KIH94_15655) comX 3036495..3036659 (-) 165 WP_015384519.1 competence pheromone ComX -
  KIH94_RS15660 (KIH94_15660) - 3036672..3037532 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  KIH94_RS15665 (KIH94_15665) degQ 3037717..3037857 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KIH94_RS20760 - 3038079..3038141 (+) 63 Protein_3041 hypothetical protein -
  KIH94_RS15670 (KIH94_15670) - 3038319..3038687 (+) 369 WP_015483634.1 hypothetical protein -
  KIH94_RS15675 (KIH94_15675) pdeH 3038663..3039892 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KIH94_RS15680 (KIH94_15680) pncB 3040029..3041501 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KIH94_RS15685 (KIH94_15685) pncA 3041517..3042068 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  KIH94_RS15690 (KIH94_15690) yueI 3042165..3042563 (-) 399 WP_015483635.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=565330 KIH94_RS15665 WP_003220708.1 3037717..3037857(-) (degQ) [Bacillus subtilis strain BYS2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=565330 KIH94_RS15665 WP_003220708.1 3037717..3037857(-) (degQ) [Bacillus subtilis strain BYS2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1