Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KIH94_RS12140 Genome accession   NZ_CP074571
Coordinates   2378161..2378544 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain BYS2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2373161..2383544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIH94_RS12100 (KIH94_12100) sinI 2374096..2374269 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KIH94_RS12105 (KIH94_12105) sinR 2374303..2374638 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KIH94_RS12110 (KIH94_12110) tasA 2374731..2375516 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KIH94_RS12115 (KIH94_12115) sipW 2375580..2376152 (-) 573 WP_080030740.1 signal peptidase I SipW -
  KIH94_RS12120 (KIH94_12120) tapA 2376136..2376897 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  KIH94_RS12125 (KIH94_12125) yqzG 2377167..2377493 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  KIH94_RS12130 (KIH94_12130) spoIITA 2377535..2377714 (-) 180 WP_003230176.1 YqzE family protein -
  KIH94_RS12135 (KIH94_12135) comGG 2377786..2378160 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KIH94_RS12140 (KIH94_12140) comGF 2378161..2378544 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  KIH94_RS12145 (KIH94_12145) comGE 2378570..2378917 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  KIH94_RS12150 (KIH94_12150) comGD 2378901..2379332 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  KIH94_RS12155 (KIH94_12155) comGC 2379322..2379618 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  KIH94_RS12160 (KIH94_12160) comGB 2379632..2380669 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  KIH94_RS12165 (KIH94_12165) comGA 2380656..2381726 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  KIH94_RS12170 (KIH94_12170) corA 2382136..2383089 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=565309 KIH94_RS12140 WP_015384087.1 2378161..2378544(-) (comGF) [Bacillus subtilis strain BYS2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=565309 KIH94_RS12140 WP_015384087.1 2378161..2378544(-) (comGF) [Bacillus subtilis strain BYS2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984