Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KIH94_RS12100 Genome accession   NZ_CP074571
Coordinates   2374096..2374269 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BYS2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2369096..2379269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIH94_RS12085 (KIH94_12085) gcvT 2369895..2370983 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  KIH94_RS12090 (KIH94_12090) hepAA 2371425..2373098 (+) 1674 WP_015384082.1 SNF2-related protein -
  KIH94_RS12095 (KIH94_12095) yqhG 2373119..2373913 (+) 795 WP_003230200.1 YqhG family protein -
  KIH94_RS12100 (KIH94_12100) sinI 2374096..2374269 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KIH94_RS12105 (KIH94_12105) sinR 2374303..2374638 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KIH94_RS12110 (KIH94_12110) tasA 2374731..2375516 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KIH94_RS12115 (KIH94_12115) sipW 2375580..2376152 (-) 573 WP_080030740.1 signal peptidase I SipW -
  KIH94_RS12120 (KIH94_12120) tapA 2376136..2376897 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  KIH94_RS12125 (KIH94_12125) yqzG 2377167..2377493 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  KIH94_RS12130 (KIH94_12130) spoIITA 2377535..2377714 (-) 180 WP_003230176.1 YqzE family protein -
  KIH94_RS12135 (KIH94_12135) comGG 2377786..2378160 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KIH94_RS12140 (KIH94_12140) comGF 2378161..2378544 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  KIH94_RS12145 (KIH94_12145) comGE 2378570..2378917 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=565306 KIH94_RS12100 WP_003230187.1 2374096..2374269(+) (sinI) [Bacillus subtilis strain BYS2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=565306 KIH94_RS12100 WP_003230187.1 2374096..2374269(+) (sinI) [Bacillus subtilis strain BYS2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1