Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KHA81_RS11950 Genome accession   NZ_CP074391
Coordinates   2488359..2488532 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain L-17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2483359..2493532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA81_RS11935 gcvT 2484177..2485277 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  KHA81_RS11940 - 2485700..2487370 (+) 1671 WP_003153107.1 SNF2-related protein -
  KHA81_RS11945 - 2487388..2488182 (+) 795 WP_014305407.1 YqhG family protein -
  KHA81_RS11950 sinI 2488359..2488532 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KHA81_RS11955 sinR 2488566..2488901 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHA81_RS11960 tasA 2488949..2489734 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  KHA81_RS11965 sipW 2489798..2490382 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KHA81_RS11970 tapA 2490354..2491025 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  KHA81_RS11975 - 2491285..2491614 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KHA81_RS11980 - 2491654..2491833 (-) 180 WP_003153093.1 YqzE family protein -
  KHA81_RS11985 comGG 2491890..2492267 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHA81_RS11990 comGF 2492268..2492768 (-) 501 WP_225879914.1 competence type IV pilus minor pilin ComGF -
  KHA81_RS11995 comGE 2492677..2492991 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KHA81_RS12000 comGD 2492975..2493412 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=564558 KHA81_RS11950 WP_003153105.1 2488359..2488532(+) (sinI) [Bacillus amyloliquefaciens strain L-17]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=564558 KHA81_RS11950 WP_003153105.1 2488359..2488532(+) (sinI) [Bacillus amyloliquefaciens strain L-17]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702