Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   KFU86_RS07605 Genome accession   NZ_CP073996
Coordinates   1554936..1555442 (+) Length   168 a.a.
NCBI ID   WP_000168274.1    Uniprot ID   A0A9X0Q0X8
Organism   Escherichia coli strain PM7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1522165..1558373 1554936..1555442 within 0


Gene organization within MGE regions


Location: 1522165..1558373
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KFU86_RS07385 (KFU86_07355) intS 1522165..1523322 (+) 1158 WP_257181885.1 prophage integrase IntS -
  KFU86_RS07390 (KFU86_07360) - 1523322..1523468 (-) 147 Protein_1455 transposase -
  KFU86_RS07395 - 1523856..1526021 (-) 2166 WP_257181886.1 phage head-binding domain-containing protein -
  KFU86_RS07400 (KFU86_07370) - 1526434..1526694 (+) 261 WP_072854989.1 Arc family DNA-binding protein -
  KFU86_RS07405 - 1527729..1528790 (-) 1062 Protein_1458 lytic transglycosylase domain-containing protein -
  KFU86_RS07410 (KFU86_07380) - 1529015..1530403 (-) 1389 WP_257180954.1 DNA transfer protein -
  KFU86_RS07415 (KFU86_07385) - 1530413..1531105 (-) 693 WP_257180955.1 DNA transfer protein -
  KFU86_RS07420 (KFU86_07390) - 1531108..1531563 (-) 456 WP_069905687.1 DUF2824 family protein -
  KFU86_RS07425 (KFU86_07395) - 1531563..1532264 (-) 702 WP_220417642.1 phage tail protein -
  KFU86_RS07430 (KFU86_07400) - 1532264..1533682 (-) 1419 WP_257180956.1 packaged DNA stabilization protein gp10 -
  KFU86_RS07435 (KFU86_07405) - 1533692..1534153 (-) 462 WP_001140510.1 packaged DNA stabilization gp4 family protein -
  KFU86_RS07440 (KFU86_07410) - 1534134..1534322 (-) 189 WP_001462613.1 hypothetical protein -
  KFU86_RS07445 (KFU86_07415) - 1534364..1535617 (-) 1254 WP_016248918.1 P22 phage major capsid protein family protein -
  KFU86_RS07450 (KFU86_07420) - 1535636..1536529 (-) 894 WP_112026415.1 scaffolding protein -
  KFU86_RS07455 (KFU86_07425) - 1536620..1538818 (-) 2199 WP_074014737.1 portal protein -
  KFU86_RS07460 (KFU86_07430) - 1538820..1540235 (-) 1416 WP_088543483.1 PBSX family phage terminase large subunit -
  KFU86_RS07465 (KFU86_07435) - 1540232..1540672 (-) 441 WP_000113732.1 hypothetical protein -
  KFU86_RS07470 (KFU86_07440) - 1540675..1540917 (-) 243 WP_000807788.1 DUF2560 family protein -
  KFU86_RS07475 (KFU86_07445) - 1541212..1541730 (-) 519 WP_001016386.1 Rha family transcriptional regulator -
  KFU86_RS07480 (KFU86_07450) - 1541932..1542084 (-) 153 WP_089577931.1 hypothetical protein -
  KFU86_RS07485 (KFU86_07455) - 1542072..1542539 (-) 468 WP_219374378.1 lysis protein -
  KFU86_RS07490 (KFU86_07460) - 1542536..1543012 (-) 477 WP_000229390.1 glycoside hydrolase family protein -
  KFU86_RS07495 (KFU86_07465) - 1542996..1543319 (-) 324 WP_000783734.1 phage holin, lambda family -
  KFU86_RS07500 (KFU86_07470) - 1543996..1544619 (-) 624 WP_001235461.1 antitermination protein -
  KFU86_RS07505 (KFU86_07475) - 1544616..1545281 (-) 666 WP_087530459.1 serine/threonine protein phosphatase -
  KFU86_RS07510 (KFU86_07480) - 1545259..1545465 (-) 207 WP_000144614.1 phage NinH family protein -
  KFU86_RS07515 (KFU86_07485) - 1545462..1546073 (-) 612 WP_039022130.1 recombination protein NinG -
  KFU86_RS07520 (KFU86_07490) - 1546066..1546242 (-) 177 WP_000950975.1 protein NinF -
  KFU86_RS07525 (KFU86_07495) - 1546235..1546618 (-) 384 WP_000386651.1 phage protein NinX family protein -
  KFU86_RS07530 (KFU86_07500) - 1546621..1546797 (-) 177 WP_000113772.1 NinE family protein -
  KFU86_RS07535 (KFU86_07505) ninD 1546764..1546967 (-) 204 WP_306576437.1 protein NinD -
  KFU86_RS07540 (KFU86_07510) - 1546934..1547374 (-) 441 WP_000736903.1 recombination protein NinB -
  KFU86_RS07545 (KFU86_07515) - 1547451..1548887 (-) 1437 WP_257180957.1 DnaB-like helicase C-terminal domain-containing protein -
  KFU86_RS07550 (KFU86_07520) - 1548877..1549776 (-) 900 WP_000065668.1 hypothetical protein -
  KFU86_RS07555 (KFU86_07525) - 1549769..1549915 (-) 147 WP_000166207.1 DUF2740 family protein -
  KFU86_RS07560 (KFU86_07530) - 1549950..1550228 (-) 279 WP_021544312.1 lambda phage CII family protein -
  KFU86_RS07565 (KFU86_07535) - 1550337..1550522 (-) 186 WP_000276886.1 Cro/CI family transcriptional regulator -
  KFU86_RS07570 (KFU86_07540) - 1550603..1551253 (+) 651 WP_000856967.1 LexA family transcriptional regulator -
  KFU86_RS07575 (KFU86_07545) - 1551568..1551840 (+) 273 WP_012817806.1 hypothetical protein -
  KFU86_RS07580 (KFU86_07550) - 1552124..1552414 (+) 291 Protein_1493 hypothetical protein -
  KFU86_RS07585 (KFU86_07555) - 1552712..1553680 (+) 969 WP_001351814.1 hypothetical protein -
  KFU86_RS07590 (KFU86_07560) - 1553705..1553836 (+) 132 WP_000638547.1 protease FtsH-inhibitory lysogeny factor CIII -
  KFU86_RS07595 (KFU86_07565) kil 1553821..1553973 (+) 153 WP_001437213.1 host cell division inhibitory peptide Kil -
  KFU86_RS07600 (KFU86_07570) - 1554228..1554935 (+) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  KFU86_RS07605 (KFU86_07575) ssb 1554936..1555442 (+) 507 WP_000168274.1 single-stranded DNA-binding protein Machinery gene
  KFU86_RS07610 (KFU86_07580) - 1555456..1555752 (+) 297 WP_087894425.1 phage anti-RecBCD protein -
  KFU86_RS07615 (KFU86_07585) - 1555763..1555930 (+) 168 WP_001214442.1 DUF2737 family protein -
  KFU86_RS07620 - 1555950..1556108 (+) 159 Protein_1501 ead/Ea22-like family protein -
  KFU86_RS07625 - 1556110..1556235 (+) 126 Protein_1502 DUF550 domain-containing protein -
  KFU86_RS23715 - 1556287..1556529 (+) 243 WP_373693134.1 dATP/dGTP pyrophosphohydrolase domain-containing protein -
  KFU86_RS07635 (KFU86_07595) - 1556907..1557149 (+) 243 WP_000476264.1 hypothetical protein -
  KFU86_RS07640 (KFU86_07600) - 1557127..1557408 (+) 282 Protein_1505 DNA polymerase III subunit theta -
  KFU86_RS07645 (KFU86_07605) - 1557498..1557665 (+) 168 WP_063114571.1 hypothetical protein -
  KFU86_RS07650 (KFU86_07610) - 1557693..1558037 (+) 345 WP_001281192.1 hypothetical protein -
  KFU86_RS07655 (KFU86_07615) torI 1558173..1558373 (+) 201 WP_001163428.1 response regulator inhibitor TorI -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18731.03 Da        Isoelectric Point: 8.4877

>NTDB_id=562714 KFU86_RS07605 WP_000168274.1 1554936..1555442(+) (ssb) [Escherichia coli strain PM7]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=562714 KFU86_RS07605 WP_000168274.1 1554936..1555442(+) (ssb) [Escherichia coli strain PM7]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAGATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.655

  ssb Glaesserella parasuis strain SC1401

45.856

100

0.494

  ssb Neisseria meningitidis MC58

38.636

100

0.405

  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405