Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KFU59_RS03620 | Genome accession | NZ_CP073915 |
| Coordinates | 757958..758443 (+) | Length | 161 a.a. |
| NCBI ID | WP_015764328.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus strain AS | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 746553..788323 | 757958..758443 | within | 0 |
Gene organization within MGE regions
Location: 746553..788323
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFU59_RS03520 (KFU59_03520) | - | 746553..747737 (-) | 1185 | WP_014569455.1 | tyrosine-type recombinase/integrase | - |
| KFU59_RS03525 (KFU59_03525) | - | 748082..749083 (-) | 1002 | WP_014569456.1 | hypothetical protein | - |
| KFU59_RS03530 (KFU59_03530) | - | 749194..749397 (-) | 204 | WP_005716134.1 | hypothetical protein | - |
| KFU59_RS13775 | - | 749421..749845 (-) | 425 | Protein_661 | pyridoxamine 5'-phosphate oxidase family protein | - |
| KFU59_RS03540 (KFU59_03540) | - | 750231..750449 (+) | 219 | WP_016364974.1 | hypothetical protein | - |
| KFU59_RS03545 (KFU59_03545) | - | 750450..751205 (-) | 756 | WP_003606998.1 | hypothetical protein | - |
| KFU59_RS03550 (KFU59_03550) | - | 751312..752012 (-) | 701 | Protein_664 | DUF3862 domain-containing protein | - |
| KFU59_RS03555 (KFU59_03555) | - | 752072..752494 (-) | 423 | WP_014569459.1 | toxin | - |
| KFU59_RS03560 (KFU59_03560) | - | 752484..752819 (-) | 336 | WP_005714743.1 | helix-turn-helix transcriptional regulator | - |
| KFU59_RS03565 (KFU59_03565) | - | 752956..753198 (+) | 243 | WP_014569460.1 | helix-turn-helix transcriptional regulator | - |
| KFU59_RS03570 (KFU59_03570) | - | 753195..753443 (+) | 249 | WP_029943629.1 | hypothetical protein | - |
| KFU59_RS03575 (KFU59_03575) | - | 753440..753667 (-) | 228 | WP_014569461.1 | hypothetical protein | - |
| KFU59_RS03580 (KFU59_03580) | - | 753755..753913 (+) | 159 | WP_014569462.1 | hypothetical protein | - |
| KFU59_RS03585 (KFU59_03585) | - | 753979..754527 (+) | 549 | WP_014569463.1 | hypothetical protein | - |
| KFU59_RS03590 (KFU59_03590) | - | 754506..754736 (+) | 231 | WP_015764912.1 | helix-turn-helix domain-containing protein | - |
| KFU59_RS13945 | - | 754740..754868 (+) | 129 | WP_014569465.1 | hypothetical protein | - |
| KFU59_RS03595 (KFU59_03595) | - | 754880..755107 (+) | 228 | WP_014569466.1 | hypothetical protein | - |
| KFU59_RS03600 (KFU59_03600) | - | 755100..755270 (+) | 171 | WP_015764913.1 | hypothetical protein | - |
| KFU59_RS03605 (KFU59_03605) | - | 755314..756189 (+) | 876 | WP_014569467.1 | RecT family recombinase | - |
| KFU59_RS03610 (KFU59_03610) | - | 756209..756973 (+) | 765 | WP_005711350.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| KFU59_RS03615 (KFU59_03615) | - | 756989..757945 (+) | 957 | WP_015764327.1 | DnaD domain protein | - |
| KFU59_RS03620 (KFU59_03620) | ssb | 757958..758443 (+) | 486 | WP_015764328.1 | single-stranded DNA-binding protein | Machinery gene |
| KFU59_RS03625 (KFU59_03625) | - | 758461..758676 (+) | 216 | WP_014569471.1 | helix-turn-helix transcriptional regulator | - |
| KFU59_RS03630 (KFU59_03630) | - | 758673..758864 (+) | 192 | WP_015764330.1 | helix-turn-helix transcriptional regulator | - |
| KFU59_RS03635 (KFU59_03635) | - | 759234..759683 (+) | 450 | WP_014569472.1 | hypothetical protein | - |
| KFU59_RS03640 (KFU59_03640) | - | 759730..759984 (+) | 255 | WP_014569473.1 | hypothetical protein | - |
| KFU59_RS03645 (KFU59_03645) | - | 760041..760382 (+) | 342 | WP_249146499.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KFU59_RS03650 (KFU59_03650) | - | 760395..760859 (+) | 465 | WP_015764333.1 | hypothetical protein | - |
| KFU59_RS03660 (KFU59_03660) | - | 761053..761559 (+) | 507 | WP_014569477.1 | DUF1642 domain-containing protein | - |
| KFU59_RS03665 (KFU59_03665) | - | 761549..761728 (+) | 180 | WP_015764915.1 | hypothetical protein | - |
| KFU59_RS03670 (KFU59_03670) | - | 761715..761918 (+) | 204 | WP_029943632.1 | hypothetical protein | - |
| KFU59_RS03675 (KFU59_03675) | - | 761908..762339 (+) | 432 | WP_014569478.1 | hypothetical protein | - |
| KFU59_RS03680 (KFU59_03680) | - | 762336..762698 (+) | 363 | WP_211751627.1 | hypothetical protein | - |
| KFU59_RS03685 (KFU59_03685) | - | 762695..762934 (+) | 240 | WP_014569479.1 | hypothetical protein | - |
| KFU59_RS03690 (KFU59_03690) | - | 762984..763166 (+) | 183 | WP_029943634.1 | hypothetical protein | - |
| KFU59_RS03695 (KFU59_03695) | - | 763461..763889 (+) | 429 | WP_005711378.1 | hypothetical protein | - |
| KFU59_RS03700 (KFU59_03700) | - | 764916..766064 (+) | 1149 | WP_014569480.1 | GcrA family cell cycle regulator | - |
| KFU59_RS03705 (KFU59_03705) | - | 766077..766619 (+) | 543 | WP_014569481.1 | NUMOD4 domain-containing protein | - |
| KFU59_RS03710 (KFU59_03710) | - | 766612..766932 (+) | 321 | WP_015764918.1 | ribonucleoside-diphosphate reductase | - |
| KFU59_RS03715 (KFU59_03715) | - | 766969..767502 (+) | 534 | WP_014569483.1 | terminase small subunit | - |
| KFU59_RS03720 (KFU59_03720) | - | 767480..768835 (+) | 1356 | WP_029943635.1 | PBSX family phage terminase large subunit | - |
| KFU59_RS03725 (KFU59_03725) | - | 768996..770266 (+) | 1271 | Protein_699 | phage portal protein | - |
| KFU59_RS03730 (KFU59_03730) | - | 770232..771224 (+) | 993 | WP_014569486.1 | minor capsid protein | - |
| KFU59_RS03735 (KFU59_03735) | - | 771349..772005 (+) | 657 | WP_014569487.1 | DUF4355 domain-containing protein | - |
| KFU59_RS03740 (KFU59_03740) | - | 772021..773034 (+) | 1014 | WP_014569488.1 | hypothetical protein | - |
| KFU59_RS03745 (KFU59_03745) | - | 773262..773636 (+) | 375 | WP_014569489.1 | phage head-tail connector protein | - |
| KFU59_RS03750 (KFU59_03750) | - | 773641..773943 (+) | 303 | WP_014569490.1 | hypothetical protein | - |
| KFU59_RS03755 (KFU59_03755) | - | 773940..774305 (+) | 366 | WP_015764920.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KFU59_RS03760 (KFU59_03760) | - | 774306..774710 (+) | 405 | WP_014569492.1 | DUF3168 domain-containing protein | - |
| KFU59_RS03765 (KFU59_03765) | - | 774722..775324 (+) | 603 | WP_014569493.1 | phage tail tube protein | - |
| KFU59_RS03770 (KFU59_03770) | - | 775411..775743 (+) | 333 | WP_014569494.1 | tail assembly chaperone | - |
| KFU59_RS03775 (KFU59_03775) | - | 775848..776201 (+) | 354 | WP_015764921.1 | hypothetical protein | - |
| KFU59_RS03780 (KFU59_03780) | - | 776194..779283 (+) | 3090 | WP_014569496.1 | tape measure protein | - |
| KFU59_RS03785 (KFU59_03785) | - | 779286..781274 (+) | 1989 | WP_211751628.1 | distal tail protein Dit | - |
| KFU59_RS03790 (KFU59_03790) | - | 781274..783780 (+) | 2507 | Protein_712 | phage tail protein | - |
| KFU59_RS03795 (KFU59_03795) | - | 783790..784113 (+) | 324 | WP_005686996.1 | hypothetical protein | - |
| KFU59_RS13780 | - | 784175..784237 (+) | 63 | WP_229041763.1 | hypothetical protein | - |
| KFU59_RS03805 (KFU59_03805) | - | 784267..784560 (+) | 294 | WP_014569500.1 | hypothetical protein | - |
| KFU59_RS03810 (KFU59_03810) | - | 784550..784963 (+) | 414 | WP_014569501.1 | phage holin | - |
| KFU59_RS03815 (KFU59_03815) | - | 784974..786272 (+) | 1299 | WP_014569502.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KFU59_RS14000 | - | 786470..786544 (+) | 75 | Protein_718 | glucose-6-phosphate isomerase | - |
| KFU59_RS03820 (KFU59_03820) | - | 786890..787177 (-) | 288 | WP_211751629.1 | putative quinol monooxygenase | - |
| KFU59_RS03825 (KFU59_03825) | - | 787472..788323 (-) | 852 | WP_005688952.1 | DNA/RNA non-specific endonuclease | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17695.41 Da Isoelectric Point: 6.9824
>NTDB_id=562237 KFU59_RS03620 WP_015764328.1 757958..758443(+) (ssb) [Lacticaseibacillus rhamnosus strain AS]
MLNSVSLTGRLTRDVDLRYTQSGTVTGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTVTGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=562237 KFU59_RS03620 WP_015764328.1 757958..758443(+) (ssb) [Lacticaseibacillus rhamnosus strain AS]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGTGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGTGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
61.047 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.509 |