Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | KFV52_RS03785 | Genome accession | NZ_CP073835 |
| Coordinates | 802721..803296 (+) | Length | 191 a.a. |
| NCBI ID | WP_001829272.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain B1230143 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 803697..846569 | 802721..803296 | flank | 401 |
Gene organization within MGE regions
Location: 802721..846569
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFV52_RS03785 (KFV52_03790) | comK/comK1 | 802721..803296 (+) | 576 | WP_001829272.1 | competence protein ComK | Regulator |
| KFV52_RS03800 (KFV52_03805) | - | 803697..804746 (-) | 1050 | WP_049391238.1 | site-specific integrase | - |
| KFV52_RS13740 | - | 804807..805388 (-) | 582 | WP_049391239.1 | hypothetical protein | - |
| KFV52_RS13745 | - | 805415..805975 (-) | 561 | Protein_724 | DUF5067 domain-containing protein | - |
| KFV52_RS03810 (KFV52_03815) | - | 806027..806665 (-) | 639 | WP_049391241.1 | XRE family transcriptional regulator | - |
| KFV52_RS03815 (KFV52_03820) | - | 806858..807118 (+) | 261 | WP_049391242.1 | helix-turn-helix transcriptional regulator | - |
| KFV52_RS03820 (KFV52_03825) | - | 807134..807847 (+) | 714 | WP_049391243.1 | BRO family protein | - |
| KFV52_RS03825 (KFV52_03830) | - | 807860..808069 (+) | 210 | WP_049367120.1 | hypothetical protein | - |
| KFV52_RS03830 (KFV52_03835) | - | 808085..808234 (+) | 150 | WP_192832187.1 | hypothetical protein | - |
| KFV52_RS03835 (KFV52_03840) | - | 808300..808476 (+) | 177 | WP_002495911.1 | hypothetical protein | - |
| KFV52_RS03840 (KFV52_03845) | - | 808538..808789 (+) | 252 | WP_002484751.1 | hypothetical protein | - |
| KFV52_RS03845 (KFV52_03850) | - | 808782..809267 (+) | 486 | WP_063280146.1 | siphovirus Gp157 family protein | - |
| KFV52_RS03850 (KFV52_03855) | - | 809268..810044 (+) | 777 | WP_012100072.1 | ATP-binding protein | - |
| KFV52_RS03855 (KFV52_03860) | - | 810073..810627 (+) | 555 | WP_002486402.1 | single-stranded DNA-binding protein | - |
| KFV52_RS03860 (KFV52_03865) | - | 810639..811304 (+) | 666 | WP_219045306.1 | putative HNHc nuclease | - |
| KFV52_RS03865 (KFV52_03870) | - | 811304..812032 (+) | 729 | WP_015984414.1 | DnaD domain protein | - |
| KFV52_RS03870 (KFV52_03875) | - | 812038..812391 (+) | 354 | WP_219045307.1 | hypothetical protein | - |
| KFV52_RS03875 (KFV52_03880) | - | 812381..813628 (+) | 1248 | WP_002504787.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| KFV52_RS03880 (KFV52_03885) | - | 813625..813855 (+) | 231 | WP_002504786.1 | hypothetical protein | - |
| KFV52_RS03885 (KFV52_03890) | - | 813824..814048 (+) | 225 | WP_002456377.1 | DUF3269 family protein | - |
| KFV52_RS03890 (KFV52_03895) | - | 814059..814475 (+) | 417 | WP_002470845.1 | DUF1064 domain-containing protein | - |
| KFV52_RS03895 (KFV52_03900) | - | 814462..814836 (+) | 375 | WP_063280144.1 | hypothetical protein | - |
| KFV52_RS03900 (KFV52_03905) | - | 814836..815027 (+) | 192 | WP_063280143.1 | hypothetical protein | - |
| KFV52_RS03905 (KFV52_03910) | - | 815028..815384 (+) | 357 | WP_063280142.1 | SA1788 family PVL leukocidin-associated protein | - |
| KFV52_RS03910 (KFV52_03915) | - | 815386..815772 (+) | 387 | WP_002505178.1 | hypothetical protein | - |
| KFV52_RS03915 (KFV52_03920) | - | 815776..816243 (+) | 468 | WP_063280141.1 | DUF3310 domain-containing protein | - |
| KFV52_RS03920 (KFV52_03925) | - | 816248..816478 (+) | 231 | WP_001830240.1 | hypothetical protein | - |
| KFV52_RS03925 (KFV52_03930) | - | 816484..817098 (+) | 615 | WP_063280152.1 | HNH endonuclease signature motif containing protein | - |
| KFV52_RS13750 | - | 817085..817270 (+) | 186 | WP_063280140.1 | hypothetical protein | - |
| KFV52_RS03930 (KFV52_03935) | - | 817267..817614 (+) | 348 | WP_063280151.1 | thermonuclease family protein | - |
| KFV52_RS03935 (KFV52_03940) | - | 817617..817913 (+) | 297 | WP_012105316.1 | hypothetical protein | - |
| KFV52_RS03940 (KFV52_03945) | - | 817903..818121 (+) | 219 | WP_012105318.1 | hypothetical protein | - |
| KFV52_RS03945 (KFV52_03950) | - | 818111..818290 (+) | 180 | WP_002468969.1 | DUF1024 family protein | - |
| KFV52_RS03950 (KFV52_03955) | - | 818283..818795 (+) | 513 | WP_049375154.1 | dUTP pyrophosphatase | - |
| KFV52_RS03955 (KFV52_03960) | - | 818845..819021 (+) | 177 | WP_049375152.1 | hypothetical protein | - |
| KFV52_RS03960 (KFV52_03965) | - | 819026..819178 (+) | 153 | WP_126534864.1 | DUF1381 domain-containing protein | - |
| KFV52_RS03965 (KFV52_03970) | - | 819171..819341 (+) | 171 | WP_002468977.1 | transcriptional activator RinB | - |
| KFV52_RS03970 (KFV52_03975) | - | 819547..819945 (+) | 399 | WP_002469495.1 | hypothetical protein | - |
| KFV52_RS03975 (KFV52_03980) | - | 819933..820073 (+) | 141 | WP_002469471.1 | hypothetical protein | - |
| KFV52_RS03980 (KFV52_03985) | - | 820076..820492 (+) | 417 | WP_001830279.1 | hypothetical protein | - |
| KFV52_RS03985 (KFV52_03990) | - | 820941..821429 (+) | 489 | WP_012097732.1 | terminase small subunit | - |
| KFV52_RS03990 (KFV52_03995) | - | 821438..822706 (+) | 1269 | WP_063280139.1 | PBSX family phage terminase large subunit | - |
| KFV52_RS03995 (KFV52_04000) | - | 822712..824136 (+) | 1425 | WP_063280138.1 | phage portal protein | - |
| KFV52_RS04000 (KFV52_04005) | - | 824105..825055 (+) | 951 | WP_063280137.1 | phage minor head protein | - |
| KFV52_RS04005 (KFV52_04010) | - | 825058..825264 (+) | 207 | WP_012097736.1 | hypothetical protein | - |
| KFV52_RS04010 (KFV52_04015) | - | 825379..825975 (+) | 597 | WP_012097738.1 | phage scaffolding protein | - |
| KFV52_RS04015 (KFV52_04020) | - | 825993..826823 (+) | 831 | WP_002470846.1 | N4-gp56 family major capsid protein | - |
| KFV52_RS04020 (KFV52_04025) | - | 826840..827130 (+) | 291 | WP_012097749.1 | Rho termination factor N-terminal domain-containing protein | - |
| KFV52_RS04025 (KFV52_04030) | - | 827130..827444 (+) | 315 | WP_002504349.1 | phage head-tail connector protein | - |
| KFV52_RS04030 (KFV52_04035) | - | 827437..827766 (+) | 330 | WP_012097751.1 | phage head closure protein | - |
| KFV52_RS04035 (KFV52_04040) | - | 827759..828172 (+) | 414 | WP_001830232.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KFV52_RS04040 (KFV52_04045) | - | 828185..828622 (+) | 438 | WP_012097753.1 | DUF3168 domain-containing protein | - |
| KFV52_RS04045 (KFV52_04050) | - | 828609..829148 (+) | 540 | WP_032604494.1 | tail protein | - |
| KFV52_RS04050 (KFV52_04055) | - | 829207..829701 (+) | 495 | WP_001830298.1 | tail assembly chaperone | - |
| KFV52_RS04055 (KFV52_04060) | - | 829764..830066 (+) | 303 | WP_001830305.1 | hypothetical protein | - |
| KFV52_RS04060 (KFV52_04065) | - | 830069..833173 (+) | 3105 | WP_219045308.1 | terminase | - |
| KFV52_RS04065 (KFV52_04070) | - | 833189..834127 (+) | 939 | WP_012095109.1 | phage tail domain-containing protein | - |
| KFV52_RS04070 (KFV52_04075) | - | 834141..835997 (+) | 1857 | WP_049371040.1 | SGNH/GDSL hydrolase family protein | - |
| KFV52_RS04075 (KFV52_04080) | - | 836012..838678 (+) | 2667 | WP_063280136.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| KFV52_RS04080 (KFV52_04085) | - | 838678..840210 (+) | 1533 | WP_219045309.1 | BppU family phage baseplate upper protein | - |
| KFV52_RS04085 (KFV52_04090) | - | 840215..840553 (+) | 339 | WP_219045310.1 | hypothetical protein | - |
| KFV52_RS04090 (KFV52_04095) | - | 840555..840695 (+) | 141 | WP_001830255.1 | XkdX family protein | - |
| KFV52_RS04095 (KFV52_04100) | - | 840733..841167 (+) | 435 | WP_002495378.1 | hypothetical protein | - |
| KFV52_RS04100 (KFV52_04105) | - | 841151..841546 (+) | 396 | WP_002495377.1 | hypothetical protein | - |
| KFV52_RS04105 (KFV52_04110) | - | 841954..843747 (+) | 1794 | Protein_785 | glucosaminidase domain-containing protein | - |
| KFV52_RS04110 (KFV52_04115) | - | 843803..844312 (+) | 510 | WP_063280132.1 | hypothetical protein | - |
| KFV52_RS04115 (KFV52_04120) | - | 844312..844842 (+) | 531 | WP_063280131.1 | hypothetical protein | - |
| KFV52_RS04120 (KFV52_04125) | - | 844897..845166 (+) | 270 | WP_049401388.1 | phage holin | - |
| KFV52_RS04125 (KFV52_04130) | - | 845166..846569 (+) | 1404 | WP_219045311.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22782.87 Da Isoelectric Point: 9.2887
>NTDB_id=561163 KFV52_RS03785 WP_001829272.1 802721..803296(+) (comK/comK1) [Staphylococcus epidermidis strain B1230143]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
Nucleotide
Download Length: 576 bp
>NTDB_id=561163 KFV52_RS03785 WP_001829272.1 802721..803296(+) (comK/comK1) [Staphylococcus epidermidis strain B1230143]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.757 |
96.859 |
0.743 |
| comK/comK1 | Staphylococcus aureus N315 |
76.757 |
96.859 |
0.743 |