Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | KEC47_RS14435 | Genome accession | NZ_CP073656 |
| Coordinates | 2997417..2997557 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain Y816 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2992417..3002557
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KEC47_RS14410 (KEC47_14410) | - | 2992744..2993127 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| KEC47_RS14415 (KEC47_14415) | comA | 2993149..2993793 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| KEC47_RS14420 (KEC47_14420) | comP | 2993874..2996180 (-) | 2307 | WP_165409405.1 | sensor histidine kinase | Regulator |
| KEC47_RS14425 (KEC47_14425) | comX | 2996199..2996375 (-) | 177 | WP_044052947.1 | competence pheromone ComX | - |
| KEC47_RS14430 (KEC47_14430) | - | 2996390..2997265 (-) | 876 | WP_146277410.1 | polyprenyl synthetase family protein | - |
| KEC47_RS14435 (KEC47_14435) | degQ | 2997417..2997557 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| KEC47_RS14440 (KEC47_14440) | - | 2998022..2998363 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| KEC47_RS14445 (KEC47_14445) | - | 2998370..2999590 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| KEC47_RS14450 (KEC47_14450) | - | 2999720..3001186 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| KEC47_RS14455 (KEC47_14455) | - | 3001204..3001755 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| KEC47_RS14460 (KEC47_14460) | - | 3001852..3002250 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=559756 KEC47_RS14435 WP_003152043.1 2997417..2997557(-) (degQ) [Bacillus velezensis strain Y816]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=559756 KEC47_RS14435 WP_003152043.1 2997417..2997557(-) (degQ) [Bacillus velezensis strain Y816]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |