Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KEC47_RS14435 Genome accession   NZ_CP073656
Coordinates   2997417..2997557 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Y816     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2992417..3002557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEC47_RS14410 (KEC47_14410) - 2992744..2993127 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  KEC47_RS14415 (KEC47_14415) comA 2993149..2993793 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KEC47_RS14420 (KEC47_14420) comP 2993874..2996180 (-) 2307 WP_165409405.1 sensor histidine kinase Regulator
  KEC47_RS14425 (KEC47_14425) comX 2996199..2996375 (-) 177 WP_044052947.1 competence pheromone ComX -
  KEC47_RS14430 (KEC47_14430) - 2996390..2997265 (-) 876 WP_146277410.1 polyprenyl synthetase family protein -
  KEC47_RS14435 (KEC47_14435) degQ 2997417..2997557 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KEC47_RS14440 (KEC47_14440) - 2998022..2998363 (+) 342 WP_014305721.1 hypothetical protein -
  KEC47_RS14445 (KEC47_14445) - 2998370..2999590 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  KEC47_RS14450 (KEC47_14450) - 2999720..3001186 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KEC47_RS14455 (KEC47_14455) - 3001204..3001755 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KEC47_RS14460 (KEC47_14460) - 3001852..3002250 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=559756 KEC47_RS14435 WP_003152043.1 2997417..2997557(-) (degQ) [Bacillus velezensis strain Y816]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=559756 KEC47_RS14435 WP_003152043.1 2997417..2997557(-) (degQ) [Bacillus velezensis strain Y816]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891