Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   KEF49_RS11805 Genome accession   NZ_CP073635
Coordinates   2360798..2361112 (-) Length   104 a.a.
NCBI ID   WP_065981881.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain Ba13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2355798..2366112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEF49_RS11760 (KEF49_11760) sinI 2356479..2356652 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  KEF49_RS11765 (KEF49_11765) sinR 2356686..2357021 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  KEF49_RS11770 (KEF49_11770) - 2357069..2357854 (-) 786 WP_013352862.1 TasA family protein -
  KEF49_RS11775 (KEF49_11775) - 2357919..2358503 (-) 585 WP_212098460.1 signal peptidase I -
  KEF49_RS11780 (KEF49_11780) tapA 2358475..2359146 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  KEF49_RS11785 (KEF49_11785) - 2359404..2359733 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  KEF49_RS11790 (KEF49_11790) - 2359774..2359953 (-) 180 WP_016938971.1 YqzE family protein -
  KEF49_RS11795 (KEF49_11795) comGG 2360010..2360387 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  KEF49_RS11800 (KEF49_11800) comGF 2360389..2360889 (-) 501 WP_249199234.1 competence type IV pilus minor pilin ComGF -
  KEF49_RS11805 (KEF49_11805) comGE 2360798..2361112 (-) 315 WP_065981881.1 competence type IV pilus minor pilin ComGE Machinery gene
  KEF49_RS11810 (KEF49_11810) comGD 2361096..2361533 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  KEF49_RS11815 (KEF49_11815) comGC 2361523..2361831 (-) 309 WP_115997634.1 competence type IV pilus major pilin ComGC Machinery gene
  KEF49_RS11820 (KEF49_11820) comGB 2361836..2362873 (-) 1038 WP_212098466.1 competence type IV pilus assembly protein ComGB Machinery gene
  KEF49_RS11825 (KEF49_11825) comGA 2362860..2363930 (-) 1071 WP_115997636.1 competence type IV pilus ATPase ComGA Machinery gene
  KEF49_RS11830 (KEF49_11830) - 2364123..2365073 (-) 951 WP_212098468.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11881.87 Da        Isoelectric Point: 7.1308

>NTDB_id=559595 KEF49_RS11805 WP_065981881.1 2360798..2361112(-) (comGE) [Bacillus amyloliquefaciens strain Ba13]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEERQEAYQLLHKHISAYMMSGKKQPSPGVTWKEDGDYYK
VCAAVRGEKEMCLSILKTEWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=559595 KEF49_RS11805 WP_065981881.1 2360798..2361112(-) (comGE) [Bacillus amyloliquefaciens strain Ba13]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACGCCAGGAAGCGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGAATGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

45.217

100

0.5