Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KEF49_RS11760 | Genome accession | NZ_CP073635 |
| Coordinates | 2356479..2356652 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain Ba13 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2351479..2361652
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KEF49_RS11745 (KEF49_11745) | gcvT | 2352290..2353390 (-) | 1101 | WP_115997629.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KEF49_RS11750 (KEF49_11750) | - | 2353814..2355484 (+) | 1671 | WP_065981874.1 | SNF2-related protein | - |
| KEF49_RS11755 (KEF49_11755) | - | 2355505..2356299 (+) | 795 | WP_065981875.1 | YqhG family protein | - |
| KEF49_RS11760 (KEF49_11760) | sinI | 2356479..2356652 (+) | 174 | WP_013352860.1 | anti-repressor SinI family protein | Regulator |
| KEF49_RS11765 (KEF49_11765) | sinR | 2356686..2357021 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| KEF49_RS11770 (KEF49_11770) | - | 2357069..2357854 (-) | 786 | WP_013352862.1 | TasA family protein | - |
| KEF49_RS11775 (KEF49_11775) | - | 2357919..2358503 (-) | 585 | WP_212098460.1 | signal peptidase I | - |
| KEF49_RS11780 (KEF49_11780) | tapA | 2358475..2359146 (-) | 672 | WP_212098462.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KEF49_RS11785 (KEF49_11785) | - | 2359404..2359733 (+) | 330 | WP_045510605.1 | DUF3889 domain-containing protein | - |
| KEF49_RS11790 (KEF49_11790) | - | 2359774..2359953 (-) | 180 | WP_016938971.1 | YqzE family protein | - |
| KEF49_RS11795 (KEF49_11795) | comGG | 2360010..2360387 (-) | 378 | WP_212098464.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KEF49_RS11800 (KEF49_11800) | comGF | 2360389..2360889 (-) | 501 | WP_249199234.1 | competence type IV pilus minor pilin ComGF | - |
| KEF49_RS11805 (KEF49_11805) | comGE | 2360798..2361112 (-) | 315 | WP_065981881.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KEF49_RS11810 (KEF49_11810) | comGD | 2361096..2361533 (-) | 438 | WP_045510590.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=559592 KEF49_RS11760 WP_013352860.1 2356479..2356652(+) (sinI) [Bacillus amyloliquefaciens strain Ba13]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=559592 KEF49_RS11760 WP_013352860.1 2356479..2356652(+) (sinI) [Bacillus amyloliquefaciens strain Ba13]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |