Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KEF49_RS11760 Genome accession   NZ_CP073635
Coordinates   2356479..2356652 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Ba13     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2351479..2361652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEF49_RS11745 (KEF49_11745) gcvT 2352290..2353390 (-) 1101 WP_115997629.1 glycine cleavage system aminomethyltransferase GcvT -
  KEF49_RS11750 (KEF49_11750) - 2353814..2355484 (+) 1671 WP_065981874.1 SNF2-related protein -
  KEF49_RS11755 (KEF49_11755) - 2355505..2356299 (+) 795 WP_065981875.1 YqhG family protein -
  KEF49_RS11760 (KEF49_11760) sinI 2356479..2356652 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  KEF49_RS11765 (KEF49_11765) sinR 2356686..2357021 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  KEF49_RS11770 (KEF49_11770) - 2357069..2357854 (-) 786 WP_013352862.1 TasA family protein -
  KEF49_RS11775 (KEF49_11775) - 2357919..2358503 (-) 585 WP_212098460.1 signal peptidase I -
  KEF49_RS11780 (KEF49_11780) tapA 2358475..2359146 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  KEF49_RS11785 (KEF49_11785) - 2359404..2359733 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  KEF49_RS11790 (KEF49_11790) - 2359774..2359953 (-) 180 WP_016938971.1 YqzE family protein -
  KEF49_RS11795 (KEF49_11795) comGG 2360010..2360387 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  KEF49_RS11800 (KEF49_11800) comGF 2360389..2360889 (-) 501 WP_249199234.1 competence type IV pilus minor pilin ComGF -
  KEF49_RS11805 (KEF49_11805) comGE 2360798..2361112 (-) 315 WP_065981881.1 competence type IV pilus minor pilin ComGE Machinery gene
  KEF49_RS11810 (KEF49_11810) comGD 2361096..2361533 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=559592 KEF49_RS11760 WP_013352860.1 2356479..2356652(+) (sinI) [Bacillus amyloliquefaciens strain Ba13]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=559592 KEF49_RS11760 WP_013352860.1 2356479..2356652(+) (sinI) [Bacillus amyloliquefaciens strain Ba13]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684