Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | KCX77_RS15955 | Genome accession | NZ_CP073265 |
| Coordinates | 3190549..3190692 (-) | Length | 47 a.a. |
| NCBI ID | WP_003327149.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain CNY01 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3185549..3195692
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCX77_RS15930 (KCX77_15930) | - | 3185906..3186286 (-) | 381 | WP_199679676.1 | hotdog fold thioesterase | - |
| KCX77_RS15935 (KCX77_15935) | comA | 3186304..3186945 (-) | 642 | WP_003327154.1 | response regulator transcription factor | Regulator |
| KCX77_RS15940 (KCX77_15940) | comP | 3187026..3189320 (-) | 2295 | WP_212063790.1 | histidine kinase | Regulator |
| KCX77_RS15945 (KCX77_15945) | comX | 3189328..3189489 (-) | 162 | WP_010789788.1 | competence pheromone ComX | - |
| KCX77_RS15950 (KCX77_15950) | - | 3189505..3190365 (-) | 861 | WP_061669434.1 | polyprenyl synthetase family protein | - |
| KCX77_RS15955 (KCX77_15955) | degQ | 3190549..3190692 (-) | 144 | WP_003327149.1 | degradation enzyme regulation protein DegQ | Regulator |
| KCX77_RS15960 (KCX77_15960) | - | 3191152..3191508 (+) | 357 | WP_010789790.1 | hypothetical protein | - |
| KCX77_RS15965 (KCX77_15965) | - | 3191527..3192759 (-) | 1233 | WP_003327147.1 | EAL and HDOD domain-containing protein | - |
| KCX77_RS15970 (KCX77_15970) | - | 3192897..3194363 (-) | 1467 | WP_010789792.1 | nicotinate phosphoribosyltransferase | - |
| KCX77_RS15975 (KCX77_15975) | - | 3194379..3194930 (-) | 552 | WP_063637896.1 | isochorismatase family cysteine hydrolase | - |
| KCX77_RS15980 (KCX77_15980) | - | 3195038..3195436 (-) | 399 | WP_003327144.1 | YueI family protein | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5645.61 Da Isoelectric Point: 8.5787
>NTDB_id=558659 KCX77_RS15955 WP_003327149.1 3190549..3190692(-) (degQ) [Bacillus atrophaeus strain CNY01]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
Nucleotide
Download Length: 144 bp
>NTDB_id=558659 KCX77_RS15955 WP_003327149.1 3190549..3190692(-) (degQ) [Bacillus atrophaeus strain CNY01]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
95.455 |
93.617 |
0.894 |