Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KCX77_RS12810 Genome accession   NZ_CP073265
Coordinates   2575209..2575574 (-) Length   121 a.a.
NCBI ID   WP_255265361.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain CNY01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2570209..2580574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KCX77_RS12760 (KCX77_12760) sinI 2570375..2570548 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  KCX77_RS12765 (KCX77_12765) sinR 2570582..2570917 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KCX77_RS12770 (KCX77_12770) - 2571110..2571892 (-) 783 WP_212063621.1 TasA family protein -
  KCX77_RS12775 (KCX77_12775) - 2571956..2572528 (-) 573 WP_010789195.1 signal peptidase I -
  KCX77_RS12780 (KCX77_12780) tapA 2572512..2573213 (-) 702 WP_212063622.1 amyloid fiber anchoring/assembly protein TapA -
  KCX77_RS12785 (KCX77_12785) - 2573475..2573798 (+) 324 WP_063638543.1 DUF3889 domain-containing protein -
  KCX77_RS12790 (KCX77_12790) - 2573845..2574024 (-) 180 WP_003325435.1 YqzE family protein -
  KCX77_RS12795 (KCX77_12795) comGG 2574094..2574468 (-) 375 WP_063638544.1 competence type IV pilus minor pilin ComGG Machinery gene
  KCX77_RS12800 (KCX77_12800) comGF 2574469..2574864 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  KCX77_RS12805 (KCX77_12805) comGE 2574878..2575225 (-) 348 WP_063638545.1 competence type IV pilus minor pilin ComGE Machinery gene
  KCX77_RS12810 (KCX77_12810) comGD 2575209..2575574 (-) 366 WP_255265361.1 competence type IV pilus minor pilin ComGD Machinery gene
  KCX77_RS12815 (KCX77_12815) comGC 2575639..2575947 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  KCX77_RS12820 (KCX77_12820) comGB 2575953..2576990 (-) 1038 WP_212063623.1 competence type IV pilus assembly protein ComGB Machinery gene
  KCX77_RS12825 (KCX77_12825) comGA 2576977..2578047 (-) 1071 WP_063638548.1 competence type IV pilus ATPase ComGA Machinery gene
  KCX77_RS12830 (KCX77_12830) - 2578428..2579381 (-) 954 WP_212063624.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 121 a.a.        Molecular weight: 13921.22 Da        Isoelectric Point: 9.4190

>NTDB_id=558640 KCX77_RS12810 WP_255265361.1 2575209..2575574(-) (comGD) [Bacillus atrophaeus strain CNY01]
MLICVFTVIPPVYKNTSARQTVARLESDILLAQQTAISKHERVRIVFLSKEHKYQIIMGASIVERTYEDWIFIECATLAD
RLDFNEKGNPNLGGKIRLKTDRLTYEMTVYLGSGKINVERK

Nucleotide


Download         Length: 366 bp        

>NTDB_id=558640 KCX77_RS12810 WP_255265361.1 2575209..2575574(-) (comGD) [Bacillus atrophaeus strain CNY01]
ATGCTGATTTGTGTTTTTACAGTCATACCTCCCGTATATAAAAATACATCTGCCCGCCAAACTGTTGCCAGGCTTGAAAG
TGACATTCTCCTCGCTCAGCAGACTGCAATTTCTAAGCATGAGCGGGTGCGTATCGTGTTTTTGTCCAAGGAACATAAGT
ACCAGATCATTATGGGGGCTAGTATCGTTGAACGAACCTATGAGGATTGGATTTTCATTGAATGTGCAACATTGGCCGAC
CGTCTTGATTTTAATGAAAAAGGAAATCCGAATTTGGGCGGGAAAATCAGGCTGAAAACAGATCGCCTCACATATGAAAT
GACTGTCTACTTAGGGAGCGGAAAAATCAATGTGGAAAGAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

53.782

98.347

0.529