Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KCX77_RS12760 Genome accession   NZ_CP073265
Coordinates   2570375..2570548 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain CNY01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2565375..2575548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KCX77_RS12745 (KCX77_12745) gcvT 2566145..2567239 (-) 1095 WP_212063620.1 glycine cleavage system aminomethyltransferase GcvT -
  KCX77_RS12750 (KCX77_12750) - 2567700..2569370 (+) 1671 WP_063638540.1 SNF2-related protein -
  KCX77_RS12755 (KCX77_12755) - 2569391..2570185 (+) 795 WP_003325443.1 YqhG family protein -
  KCX77_RS12760 (KCX77_12760) sinI 2570375..2570548 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  KCX77_RS12765 (KCX77_12765) sinR 2570582..2570917 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KCX77_RS12770 (KCX77_12770) - 2571110..2571892 (-) 783 WP_212063621.1 TasA family protein -
  KCX77_RS12775 (KCX77_12775) - 2571956..2572528 (-) 573 WP_010789195.1 signal peptidase I -
  KCX77_RS12780 (KCX77_12780) tapA 2572512..2573213 (-) 702 WP_212063622.1 amyloid fiber anchoring/assembly protein TapA -
  KCX77_RS12785 (KCX77_12785) - 2573475..2573798 (+) 324 WP_063638543.1 DUF3889 domain-containing protein -
  KCX77_RS12790 (KCX77_12790) - 2573845..2574024 (-) 180 WP_003325435.1 YqzE family protein -
  KCX77_RS12795 (KCX77_12795) comGG 2574094..2574468 (-) 375 WP_063638544.1 competence type IV pilus minor pilin ComGG Machinery gene
  KCX77_RS12800 (KCX77_12800) comGF 2574469..2574864 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  KCX77_RS12805 (KCX77_12805) comGE 2574878..2575225 (-) 348 WP_063638545.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=558635 KCX77_RS12760 WP_003325442.1 2570375..2570548(+) (sinI) [Bacillus atrophaeus strain CNY01]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=558635 KCX77_RS12760 WP_003325442.1 2570375..2570548(+) (sinI) [Bacillus atrophaeus strain CNY01]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789