Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   LT978_RS07545 Genome accession   NZ_CP090838
Coordinates   1464327..1464722 (+) Length   131 a.a.
NCBI ID   WP_046559876.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain TL106     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1459327..1469722
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT978_RS07515 (LT978_07510) - 1460039..1460989 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  LT978_RS07520 (LT978_07515) comGA 1461181..1462251 (+) 1071 WP_139890048.1 competence type IV pilus ATPase ComGA Machinery gene
  LT978_RS07525 (LT978_07520) comGB 1462238..1463275 (+) 1038 WP_139890049.1 competence type IV pilus assembly protein ComGB Machinery gene
  LT978_RS07530 (LT978_07525) comGC 1463280..1463588 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LT978_RS07535 (LT978_07530) comGD 1463578..1464015 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  LT978_RS07540 (LT978_07535) comGE 1463999..1464313 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LT978_RS07545 (LT978_07540) comGF 1464327..1464722 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF Machinery gene
  LT978_RS07550 (LT978_07545) comGG 1464723..1465100 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LT978_RS07555 (LT978_07550) - 1465157..1465336 (+) 180 WP_003153093.1 YqzE family protein -
  LT978_RS07560 (LT978_07555) - 1465376..1465705 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LT978_RS07565 (LT978_07560) tapA 1465965..1466636 (+) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LT978_RS07570 (LT978_07565) sipW 1466608..1467192 (+) 585 WP_109567595.1 signal peptidase I SipW -
  LT978_RS07575 (LT978_07570) tasA 1467256..1468041 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  LT978_RS07580 (LT978_07575) sinR 1468089..1468424 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LT978_RS07585 (LT978_07580) sinI 1468458..1468631 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LT978_RS07590 (LT978_07585) - 1468808..1469602 (-) 795 WP_139890050.1 YqhG family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14197.45 Da        Isoelectric Point: 9.6547

>NTDB_id=555664 LT978_RS07545 WP_046559876.1 1464327..1464722(+) (comGF) [Bacillus amyloliquefaciens strain TL106]
MAVCLFLSGTLGPILHLFLSNRTDNGGLDSREHQIAVQQIMNECKQAETVKPADGGRALACRKTGGEEVRFEIYHKMIRK
RVNGKGHVPILQNAASLTADVKNGLLLLEISSVTGKKNQAVIPVYSSLKGD

Nucleotide


Download         Length: 396 bp        

>NTDB_id=555664 LT978_RS07545 WP_046559876.1 1464327..1464722(+) (comGF) [Bacillus amyloliquefaciens strain TL106]
TTGGCAGTCTGTCTTTTCCTATCAGGCACCCTGGGCCCGATTTTACATCTGTTTTTATCAAACCGGACCGATAACGGCGG
ATTAGACAGCCGGGAGCATCAAATTGCCGTTCAGCAGATCATGAACGAATGTAAACAGGCTGAGACTGTGAAGCCGGCCG
ACGGCGGGCGGGCGTTAGCATGCCGGAAAACAGGGGGCGAAGAAGTGCGTTTTGAAATTTATCATAAGATGATAAGGAAA
AGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAACGGCCTGCTCTT
ATTAGAGATCTCAAGTGTTACAGGTAAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTAAAAGGTGATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

47.619

96.183

0.458