Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   J8Y18_RS18895 Genome accession   NZ_CP072774
Coordinates   3738577..3739356 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain BC33     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3713284..3775042 3738577..3739356 within 0


Gene organization within MGE regions


Location: 3713284..3775042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8Y18_RS18785 (J8Y18_18785) - 3713854..3714753 (-) 900 WP_211477793.1 polysaccharide deacetylase family protein -
  J8Y18_RS18790 (J8Y18_18790) pnp 3714905..3717043 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  J8Y18_RS18795 (J8Y18_18795) rpsO 3717204..3717473 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  J8Y18_RS18800 (J8Y18_18800) ribF 3717574..3718545 (-) 972 WP_211477794.1 bifunctional riboflavin kinase/FAD synthetase -
  J8Y18_RS18805 (J8Y18_18805) truB 3718589..3719512 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  J8Y18_RS18810 (J8Y18_18810) rbfA 3719599..3719955 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  J8Y18_RS18815 (J8Y18_18815) - 3719971..3720252 (-) 282 WP_000582363.1 DUF503 family protein -
  J8Y18_RS18820 (J8Y18_18820) infB 3720249..3722309 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  J8Y18_RS18825 (J8Y18_18825) - 3722314..3722625 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  J8Y18_RS18830 (J8Y18_18830) - 3722626..3722898 (-) 273 WP_000071127.1 YlxR family protein -
  J8Y18_RS18835 (J8Y18_18835) nusA 3722910..3724016 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  J8Y18_RS18840 (J8Y18_18840) rimP 3724034..3724504 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  J8Y18_RS18845 (J8Y18_18845) - 3724841..3729142 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  J8Y18_RS18850 (J8Y18_18850) - 3729267..3730967 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  J8Y18_RS18855 (J8Y18_18855) rseP 3731077..3732333 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  J8Y18_RS18860 (J8Y18_18860) dxr 3732351..3733493 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  J8Y18_RS18865 (J8Y18_18865) cdsA 3733517..3734308 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  J8Y18_RS18870 (J8Y18_18870) uppS 3734326..3735102 (-) 777 WP_000971296.1 isoprenyl transferase -
  J8Y18_RS18875 (J8Y18_18875) frr 3735188..3735745 (-) 558 WP_000531501.1 ribosome recycling factor -
  J8Y18_RS18880 (J8Y18_18880) pyrH 3735748..3736470 (-) 723 WP_000042668.1 UMP kinase -
  J8Y18_RS18885 (J8Y18_18885) tsf 3736537..3737424 (-) 888 WP_001018578.1 translation elongation factor Ts -
  J8Y18_RS18890 (J8Y18_18890) rpsB 3737528..3738229 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  J8Y18_RS18895 (J8Y18_18895) codY 3738577..3739356 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  J8Y18_RS18900 (J8Y18_18900) hslU 3739434..3740825 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  J8Y18_RS18905 (J8Y18_18905) hslV 3740848..3741390 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  J8Y18_RS18910 (J8Y18_18910) xerC 3741433..3742332 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  J8Y18_RS18915 (J8Y18_18915) trmFO 3742398..3743702 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  J8Y18_RS18920 (J8Y18_18920) topA 3743751..3745829 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  J8Y18_RS18925 (J8Y18_18925) dprA 3745974..3746843 (-) 870 WP_211477795.1 DNA-processing protein DprA -
  J8Y18_RS18930 (J8Y18_18930) sucD 3746932..3747834 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  J8Y18_RS18935 (J8Y18_18935) sucC 3747854..3749014 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  J8Y18_RS18940 (J8Y18_18940) - 3749209..3749982 (-) 774 WP_001194265.1 ribonuclease HII -
  J8Y18_RS18945 (J8Y18_18945) ylqF 3750039..3750929 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  J8Y18_RS18950 (J8Y18_18950) lepB 3750950..3751501 (-) 552 WP_000711853.1 signal peptidase I -
  J8Y18_RS18955 (J8Y18_18955) rplS 3751603..3751947 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  J8Y18_RS18960 (J8Y18_18960) trmD 3752094..3752828 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  J8Y18_RS18965 (J8Y18_18965) rimM 3752828..3753343 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  J8Y18_RS18970 (J8Y18_18970) - 3753465..3753692 (-) 228 WP_000737401.1 KH domain-containing protein -
  J8Y18_RS18975 (J8Y18_18975) rpsP 3753707..3753979 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  J8Y18_RS18980 (J8Y18_18980) ffh 3754081..3755430 (-) 1350 WP_000863460.1 signal recognition particle protein -
  J8Y18_RS18985 (J8Y18_18985) - 3755443..3755775 (-) 333 WP_000891062.1 putative DNA-binding protein -
  J8Y18_RS18990 (J8Y18_18990) ftsY 3755909..3756898 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  J8Y18_RS18995 (J8Y18_18995) smc 3756914..3760483 (-) 3570 WP_000478973.1 chromosome segregation protein SMC -
  J8Y18_RS19000 (J8Y18_19000) rncS 3760630..3761367 (-) 738 WP_001146875.1 ribonuclease III -
  J8Y18_RS19005 (J8Y18_19005) acpP 3761426..3761659 (-) 234 WP_000786062.1 acyl carrier protein -
  J8Y18_RS19010 (J8Y18_19010) fabG 3761729..3762469 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  J8Y18_RS19015 (J8Y18_19015) fabD 3762469..3763413 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  J8Y18_RS19020 (J8Y18_19020) plsX 3763428..3764420 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  J8Y18_RS19025 (J8Y18_19025) fapR 3764417..3765010 (-) 594 WP_000747348.1 transcription factor FapR -
  J8Y18_RS19030 (J8Y18_19030) recG 3765099..3767147 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  J8Y18_RS19035 (J8Y18_19035) - 3767438..3769114 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  J8Y18_RS19040 (J8Y18_19040) - 3769137..3769499 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  J8Y18_RS19045 (J8Y18_19045) rpmB 3769876..3770064 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  J8Y18_RS19050 (J8Y18_19050) spoVM 3770138..3770218 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  J8Y18_RS19055 (J8Y18_19055) - 3770285..3770965 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  J8Y18_RS19060 (J8Y18_19060) rpe 3771034..3771678 (-) 645 WP_000589971.1 ribulose-phosphate 3-epimerase -
  J8Y18_RS19065 (J8Y18_19065) rsgA 3771681..3772562 (-) 882 WP_001135536.1 ribosome small subunit-dependent GTPase A -
  J8Y18_RS19070 (J8Y18_19070) pknB 3772809..3774782 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=555506 J8Y18_RS18895 WP_000421290.1 3738577..3739356(-) (codY) [Bacillus cereus strain BC33]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=555506 J8Y18_RS18895 WP_000421290.1 3738577..3739356(-) (codY) [Bacillus cereus strain BC33]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459