Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J6600_RS11745 Genome accession   NZ_CP072563
Coordinates   2467682..2467855 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus sp. LJBV19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2462682..2472855
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6600_RS11730 (J6600_11730) gcvT 2463495..2464595 (-) 1101 WP_209388349.1 glycine cleavage system aminomethyltransferase GcvT -
  J6600_RS11735 (J6600_11735) - 2465019..2466689 (+) 1671 WP_209387429.1 SNF2-related protein -
  J6600_RS11740 (J6600_11740) - 2466711..2467505 (+) 795 WP_014418368.1 YqhG family protein -
  J6600_RS11745 (J6600_11745) sinI 2467682..2467855 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  J6600_RS11750 (J6600_11750) sinR 2467889..2468224 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J6600_RS11755 (J6600_11755) - 2468272..2469057 (-) 786 WP_007408329.1 TasA family protein -
  J6600_RS11760 (J6600_11760) - 2469123..2469707 (-) 585 WP_003153100.1 signal peptidase I -
  J6600_RS11765 (J6600_11765) tapA 2469679..2470350 (-) 672 WP_209387430.1 amyloid fiber anchoring/assembly protein TapA -
  J6600_RS11770 (J6600_11770) - 2470609..2470938 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  J6600_RS11775 (J6600_11775) - 2470979..2471158 (-) 180 WP_003153093.1 YqzE family protein -
  J6600_RS11780 (J6600_11780) comGG 2471215..2471592 (-) 378 WP_095272391.1 competence type IV pilus minor pilin ComGG Machinery gene
  J6600_RS11785 (J6600_11785) comGF 2471593..2471988 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  J6600_RS11790 (J6600_11790) comGE 2472002..2472316 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  J6600_RS11795 (J6600_11795) comGD 2472300..2472737 (-) 438 WP_209387431.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=554234 J6600_RS11745 WP_014418369.1 2467682..2467855(+) (sinI) [Bacillus sp. LJBV19]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=554234 J6600_RS11745 WP_014418369.1 2467682..2467855(+) (sinI) [Bacillus sp. LJBV19]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719