Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | J6600_RS11745 | Genome accession | NZ_CP072563 |
| Coordinates | 2467682..2467855 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus sp. LJBV19 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2462682..2472855
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J6600_RS11730 (J6600_11730) | gcvT | 2463495..2464595 (-) | 1101 | WP_209388349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| J6600_RS11735 (J6600_11735) | - | 2465019..2466689 (+) | 1671 | WP_209387429.1 | SNF2-related protein | - |
| J6600_RS11740 (J6600_11740) | - | 2466711..2467505 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| J6600_RS11745 (J6600_11745) | sinI | 2467682..2467855 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| J6600_RS11750 (J6600_11750) | sinR | 2467889..2468224 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| J6600_RS11755 (J6600_11755) | - | 2468272..2469057 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| J6600_RS11760 (J6600_11760) | - | 2469123..2469707 (-) | 585 | WP_003153100.1 | signal peptidase I | - |
| J6600_RS11765 (J6600_11765) | tapA | 2469679..2470350 (-) | 672 | WP_209387430.1 | amyloid fiber anchoring/assembly protein TapA | - |
| J6600_RS11770 (J6600_11770) | - | 2470609..2470938 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| J6600_RS11775 (J6600_11775) | - | 2470979..2471158 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| J6600_RS11780 (J6600_11780) | comGG | 2471215..2471592 (-) | 378 | WP_095272391.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| J6600_RS11785 (J6600_11785) | comGF | 2471593..2471988 (-) | 396 | WP_021494311.1 | competence type IV pilus minor pilin ComGF | - |
| J6600_RS11790 (J6600_11790) | comGE | 2472002..2472316 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| J6600_RS11795 (J6600_11795) | comGD | 2472300..2472737 (-) | 438 | WP_209387431.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=554234 J6600_RS11745 WP_014418369.1 2467682..2467855(+) (sinI) [Bacillus sp. LJBV19]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=554234 J6600_RS11745 WP_014418369.1 2467682..2467855(+) (sinI) [Bacillus sp. LJBV19]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |