Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   J6600_RS11790 Genome accession   NZ_CP072563
Coordinates   2472002..2472316 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus sp. LJBV19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2467002..2477316
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6600_RS11745 (J6600_11745) sinI 2467682..2467855 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  J6600_RS11750 (J6600_11750) sinR 2467889..2468224 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J6600_RS11755 (J6600_11755) - 2468272..2469057 (-) 786 WP_007408329.1 TasA family protein -
  J6600_RS11760 (J6600_11760) - 2469123..2469707 (-) 585 WP_003153100.1 signal peptidase I -
  J6600_RS11765 (J6600_11765) tapA 2469679..2470350 (-) 672 WP_209387430.1 amyloid fiber anchoring/assembly protein TapA -
  J6600_RS11770 (J6600_11770) - 2470609..2470938 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  J6600_RS11775 (J6600_11775) - 2470979..2471158 (-) 180 WP_003153093.1 YqzE family protein -
  J6600_RS11780 (J6600_11780) comGG 2471215..2471592 (-) 378 WP_095272391.1 competence type IV pilus minor pilin ComGG Machinery gene
  J6600_RS11785 (J6600_11785) comGF 2471593..2471988 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  J6600_RS11790 (J6600_11790) comGE 2472002..2472316 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  J6600_RS11795 (J6600_11795) comGD 2472300..2472737 (-) 438 WP_209387431.1 competence type IV pilus minor pilin ComGD Machinery gene
  J6600_RS11800 (J6600_11800) comGC 2472727..2473035 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  J6600_RS11805 (J6600_11805) comGB 2473040..2474077 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  J6600_RS11810 (J6600_11810) comGA 2474064..2475134 (-) 1071 WP_209387432.1 competence type IV pilus ATPase ComGA Machinery gene
  J6600_RS11815 (J6600_11815) - 2475327..2476277 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=554237 J6600_RS11790 WP_017418140.1 2472002..2472316(-) (comGE) [Bacillus sp. LJBV19]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=554237 J6600_RS11790 WP_017418140.1 2472002..2472316(-) (comGE) [Bacillus sp. LJBV19]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481