Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J7W01_RS16465 Genome accession   NZ_CP072525
Coordinates   3176402..3176542 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain YB-04     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3171402..3181542
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7W01_RS16440 (J7W01_16440) yuxO 3171745..3172125 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  J7W01_RS16445 (J7W01_16445) comA 3172144..3172788 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  J7W01_RS16450 (J7W01_16450) comP 3172869..3175169 (-) 2301 WP_088300729.1 histidine kinase Regulator
  J7W01_RS16455 (J7W01_16455) comX 3175181..3175345 (-) 165 WP_015384519.1 competence pheromone ComX -
  J7W01_RS16460 (J7W01_16460) - 3175358..3176218 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  J7W01_RS16465 (J7W01_16465) degQ 3176402..3176542 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  J7W01_RS21525 - 3176764..3176826 (+) 63 Protein_3203 hypothetical protein -
  J7W01_RS16470 (J7W01_16470) - 3177005..3177373 (+) 369 WP_041850584.1 hypothetical protein -
  J7W01_RS16475 (J7W01_16475) pdeH 3177349..3178578 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  J7W01_RS16480 (J7W01_16480) pncB 3178715..3180187 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  J7W01_RS16485 (J7W01_16485) pncA 3180203..3180754 (-) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  J7W01_RS16490 (J7W01_16490) yueI 3180851..3181249 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=553995 J7W01_RS16465 WP_003220708.1 3176402..3176542(-) (degQ) [Bacillus subtilis strain YB-04]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=553995 J7W01_RS16465 WP_003220708.1 3176402..3176542(-) (degQ) [Bacillus subtilis strain YB-04]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1