Detailed information    

insolico Bioinformatically predicted

Overview

Name   comL   Type   Machinery gene
Locus tag   J7445_RS05820 Genome accession   NZ_CP072524
Coordinates   1238390..1239196 (-) Length   268 a.a.
NCBI ID   WP_070538918.1    Uniprot ID   -
Organism   Neisseria sicca strain NS20201025     
Function   DNA processing; DNA transport into the cytoplasm (predicted from homology)   
DNA processing DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1202256..1250340 1238390..1239196 within 0


Gene organization within MGE regions


Location: 1202256..1250340
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7445_RS05630 (J7445_05630) - 1204056..1204862 (-) 807 WP_209283300.1 integrase core domain-containing protein -
  J7445_RS05635 (J7445_05635) - 1205005..1205565 (+) 561 WP_209283301.1 YceI family protein -
  J7445_RS05640 (J7445_05640) - 1205714..1206280 (+) 567 WP_019270206.1 peptidylprolyl isomerase -
  J7445_RS05645 (J7445_05645) - 1206393..1206878 (-) 486 WP_039855981.1 DUF4189 domain-containing protein -
  J7445_RS05650 (J7445_05650) - 1207009..1207359 (-) 351 WP_154885740.1 helix-turn-helix domain-containing protein -
  J7445_RS05655 (J7445_05655) - 1207522..1208394 (+) 873 WP_154885727.1 pirin family protein -
  J7445_RS05660 (J7445_05660) - 1208811..1209062 (+) 252 WP_154885726.1 hypothetical protein -
  J7445_RS05665 (J7445_05665) - 1209105..1209434 (+) 330 WP_003743017.1 hypothetical protein -
  J7445_RS05670 (J7445_05670) nrdD 1209596..1211377 (-) 1782 WP_154885725.1 anaerobic ribonucleoside-triphosphate reductase -
  J7445_RS05675 (J7445_05675) nrdG 1211413..1211949 (-) 537 WP_154885724.1 anaerobic ribonucleoside-triphosphate reductase activating protein -
  J7445_RS05680 (J7445_05680) - 1212569..1212937 (+) 369 WP_209283302.1 DUF5339 family protein -
  J7445_RS05685 (J7445_05685) - 1213161..1213529 (-) 369 WP_244969528.1 transposase -
  J7445_RS05690 (J7445_05690) - 1213546..1213689 (-) 144 WP_209283383.1 hypothetical protein -
  J7445_RS05695 (J7445_05695) - 1213973..1215724 (-) 1752 WP_209283303.1 ATP-binding protein -
  J7445_RS05700 (J7445_05700) uvrA 1215711..1218605 (-) 2895 WP_209283304.1 excinuclease ABC subunit UvrA -
  J7445_RS05705 (J7445_05705) - 1218825..1219625 (+) 801 WP_101810773.1 phosphatidylserine decarboxylase -
  J7445_RS05710 (J7445_05710) - 1219622..1219804 (-) 183 WP_209283305.1 hypothetical protein -
  J7445_RS05715 (J7445_05715) - 1219912..1220307 (+) 396 WP_209283306.1 helix-turn-helix transcriptional regulator -
  J7445_RS05720 (J7445_05720) - 1220495..1220926 (+) 432 Protein_1113 helix-turn-helix transcriptional regulator -
  J7445_RS05725 (J7445_05725) - 1221026..1221991 (+) 966 WP_209283307.1 IS30 family transposase -
  J7445_RS05730 (J7445_05730) - 1222023..1222232 (-) 210 WP_209283308.1 hypothetical protein -
  J7445_RS05735 (J7445_05735) - 1222246..1222587 (-) 342 WP_342356187.1 hypothetical protein -
  J7445_RS05740 (J7445_05740) - 1222556..1222894 (-) 339 WP_070442141.1 general secretion pathway protein GspG -
  J7445_RS05745 (J7445_05745) - 1223040..1224221 (+) 1182 WP_209283309.1 aspartate aminotransferase family protein -
  J7445_RS05750 (J7445_05750) - 1224474..1225409 (+) 936 WP_209283310.1 dihydroorotate oxidase -
  J7445_RS05755 (J7445_05755) ygiD 1225663..1226448 (-) 786 WP_209283311.1 4,5-DOPA dioxygenase extradiol -
  J7445_RS05760 (J7445_05760) - 1226717..1227928 (-) 1212 WP_070635939.1 NADH:flavin oxidoreductase/NADH oxidase family protein -
  J7445_RS05765 (J7445_05765) - 1228003..1228314 (-) 312 WP_209283312.1 metalloregulator ArsR/SmtB family transcription factor -
  J7445_RS05770 (J7445_05770) - 1228582..1228917 (-) 336 WP_023887410.1 thioredoxin family protein -
  J7445_RS05775 (J7445_05775) - 1229010..1229339 (-) 330 WP_019270184.1 OsmC family protein -
  J7445_RS05780 (J7445_05780) cueR 1229620..1230012 (-) 393 WP_003742986.1 Cu(I)-responsive transcriptional regulator -
  J7445_RS05785 (J7445_05785) - 1230160..1230369 (+) 210 WP_003674677.1 heavy-metal-associated domain-containing protein -
  J7445_RS05790 (J7445_05790) - 1230470..1232635 (+) 2166 WP_209283313.1 heavy metal translocating P-type ATPase -
  J7445_RS05795 (J7445_05795) ttcA 1232790..1233749 (+) 960 WP_203026279.1 tRNA 2-thiocytidine(32) synthetase TtcA -
  J7445_RS05800 (J7445_05800) - 1233976..1234464 (+) 489 WP_070635945.1 DUF456 family protein -
  J7445_RS05805 (J7445_05805) - 1234536..1235198 (-) 663 WP_209283314.1 YecA family protein -
  J7445_RS05810 (J7445_05810) - 1235284..1236537 (-) 1254 WP_209283315.1 D-alanyl-D-alanine carboxypeptidase family protein -
  J7445_RS05815 (J7445_05815) ilvA 1236753..1238279 (+) 1527 WP_070655696.1 threonine ammonia-lyase, biosynthetic -
  J7445_RS05820 (J7445_05820) comL 1238390..1239196 (-) 807 WP_070538918.1 outer membrane protein assembly factor BamD Machinery gene
  J7445_RS05825 (J7445_05825) rluD 1239195..1240319 (+) 1125 WP_019270176.1 23S rRNA pseudouridine(1911/1915/1917) synthase RluD -
  J7445_RS05830 (J7445_05830) - 1240402..1240986 (+) 585 WP_019270175.1 hypothetical protein -
  J7445_RS05835 (J7445_05835) pgeF 1241028..1241801 (+) 774 WP_209283316.1 peptidoglycan editing factor PgeF -
  J7445_RS05840 (J7445_05840) yciA 1241906..1242343 (+) 438 WP_003742967.1 acyl-CoA thioester hydrolase YciA -
  J7445_RS05845 (J7445_05845) - 1242457..1243554 (-) 1098 WP_209283317.1 NnrS family protein -
  J7445_RS05850 (J7445_05850) - 1243850..1244464 (-) 615 WP_070538915.1 CadD family cadmium resistance transporter -
  J7445_RS05855 (J7445_05855) - 1244775..1245467 (-) 693 WP_209283357.1 ATP-binding cassette domain-containing protein -
  J7445_RS05860 (J7445_05860) - 1245467..1246264 (-) 798 WP_049230919.1 ABC transporter permease subunit -
  J7445_RS05865 (J7445_05865) - 1246455..1247159 (-) 705 WP_209283318.1 hypothetical protein -
  J7445_RS05870 (J7445_05870) - 1247226..1247414 (+) 189 WP_209283319.1 hypothetical protein -
  J7445_RS05875 (J7445_05875) - 1247498..1248475 (-) 978 WP_209283320.1 ABC transporter substrate-binding protein -
  J7445_RS05880 (J7445_05880) - 1248799..1249683 (-) 885 WP_070679764.1 DMT family transporter -

Sequence

Protein


Download         Length: 268 a.a.        Molecular weight: 31225.24 Da        Isoelectric Point: 7.9863

>NTDB_id=553909 J7445_RS05820 WP_070538918.1 1238390..1239196(-) (comL) [Neisseria sicca strain NS20201025]
MKKILLVVSLSLALGACASNKGTVDKDAQITQDWNVEKLYAEAHDELNSSNYTRAIKLYEILESRFPNGRYAQQAQLDTA
YAYYKDDEPEKALAAIDRFQRHHPQHPNMDYALYLKGLVLFNEDQSFLNKLASQDWSDRDPKANRSAYQAFAELVQRYPE
SKYAADATERMAKLVDALGGNEISVARYYMKRGAYLAAVNRAQKIVERYQNTRYVEESLAMMELAYKKLEKPQLAADTRR
VLETNFPQSPFLQHQWQPNDMPWWRYWR

Nucleotide


Download         Length: 807 bp        

>NTDB_id=553909 J7445_RS05820 WP_070538918.1 1238390..1239196(-) (comL) [Neisseria sicca strain NS20201025]
ATGAAAAAAATTCTTTTAGTAGTTTCGTTAAGTCTGGCACTCGGTGCCTGTGCAAGCAATAAAGGTACGGTCGATAAAGA
CGCGCAAATCACACAAGATTGGAACGTGGAAAAACTCTATGCCGAAGCGCATGACGAGTTGAACAGCAGCAATTATACGC
GAGCCATCAAGTTATACGAAATTTTAGAATCCCGCTTCCCCAACGGCCGCTACGCGCAACAGGCGCAACTGGATACCGCA
TACGCCTATTACAAAGACGACGAGCCTGAAAAAGCCCTCGCCGCCATCGACCGCTTCCAGCGCCATCACCCGCAACATCC
GAATATGGATTACGCGCTTTACCTCAAAGGCTTGGTTTTATTCAATGAAGACCAATCCTTCCTCAACAAACTCGCTTCTC
AAGACTGGTCCGACCGCGACCCTAAAGCCAACCGCAGCGCATACCAAGCATTTGCCGAATTGGTACAACGCTATCCGGAG
AGCAAATACGCAGCCGACGCAACCGAGCGCATGGCAAAACTGGTGGACGCATTGGGCGGTAACGAAATCTCCGTTGCCCG
CTACTACATGAAACGCGGCGCCTACCTTGCCGCTGTTAACCGTGCCCAAAAAATCGTCGAGCGTTACCAAAACACCCGCT
ACGTAGAAGAATCGCTCGCCATGATGGAGCTTGCCTACAAGAAACTGGAAAAACCCCAACTCGCCGCCGACACCCGCCGC
GTCTTGGAAACCAACTTCCCGCAAAGCCCCTTCCTGCAACACCAATGGCAGCCAAACGACATGCCTTGGTGGCGCTACTG
GCGTTAA

Domains

Predicted by InterproScan.

Outer membrane lipoprotein (YfiO)

(35-239)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comL Neisseria gonorrhoeae MS11

85.019

99.627

0.847
  comL Neisseria meningitidis MC58

85.019

99.627

0.847