Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   J7U08_RS00040 Genome accession   NZ_CP072449
Coordinates   9256..9834 (+) Length   192 a.a.
NCBI ID   WP_003616385.1    Uniprot ID   A0A2I1SID3
Organism   Lactobacillus delbrueckii subsp. lactis strain L24754     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1550..39100 9256..9834 within 0


Gene organization within MGE regions


Location: 1550..39100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7U08_RS00010 (J7U08_00010) dnaN 1550..2677 (+) 1128 WP_003616390.1 DNA polymerase III subunit beta -
  J7U08_RS00015 (J7U08_00015) yaaA 2902..3132 (+) 231 WP_003623647.1 S4 domain-containing protein YaaA -
  J7U08_RS00020 (J7U08_00020) recF 3132..4277 (+) 1146 WP_035162079.1 DNA replication/repair protein RecF -
  J7U08_RS00025 (J7U08_00025) gyrB 4261..6222 (+) 1962 WP_003616387.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  J7U08_RS00030 (J7U08_00030) gyrA 6235..8706 (+) 2472 WP_002879428.1 DNA gyrase subunit A -
  J7U08_RS00035 (J7U08_00035) rpsF 8922..9215 (+) 294 WP_003612647.1 30S ribosomal protein S6 -
  J7U08_RS00040 (J7U08_00040) ssb 9256..9834 (+) 579 WP_003616385.1 single-stranded DNA-binding protein Machinery gene
  J7U08_RS00045 (J7U08_00045) rpsR 9861..10097 (+) 237 WP_002879432.1 30S ribosomal protein S18 -
  J7U08_RS00050 (J7U08_00050) - 10238..12259 (+) 2022 WP_002879433.1 DHH family phosphoesterase -
  J7U08_RS00055 (J7U08_00055) rplI 12282..12737 (+) 456 WP_013438865.1 50S ribosomal protein L9 -
  J7U08_RS00060 (J7U08_00060) dnaB 12761..14131 (+) 1371 WP_016396059.1 replicative DNA helicase -
  J7U08_RS00065 (J7U08_00065) - 14180..15337 (-) 1158 WP_003616382.1 DUF2974 domain-containing protein -
  J7U08_RS00070 (J7U08_00070) - 15609..16896 (-) 1288 Protein_13 RNA-guided endonuclease InsQ/TnpB family protein -
  J7U08_RS00075 (J7U08_00075) - 17264..17422 (+) 159 WP_231520548.1 hypothetical protein -
  J7U08_RS00080 (J7U08_00080) - 17589..18293 (-) 705 WP_138490787.1 MgtC/SapB family protein -
  J7U08_RS00090 (J7U08_00090) - 18689..20068 (-) 1380 WP_041812154.1 IS3-like element ISL6 family transposase -
  J7U08_RS00095 (J7U08_00095) - 20151..20984 (+) 834 WP_138491063.1 helix-turn-helix domain-containing protein -
  J7U08_RS00100 (J7U08_00100) - 21363..21800 (+) 438 WP_207577469.1 hypothetical protein -
  J7U08_RS00105 (J7U08_00105) - 21925..22959 (+) 1035 WP_074027720.1 IS30 family transposase -
  J7U08_RS00110 (J7U08_00110) - 23057..23995 (+) 939 WP_138490866.1 ABC transporter ATP-binding protein -
  J7U08_RS00120 (J7U08_00120) - 24276..24723 (+) 448 Protein_21 Rrf2 family transcriptional regulator -
  J7U08_RS00125 (J7U08_00125) - 24819..25118 (+) 300 WP_372393392.1 alcohol dehydrogenase catalytic domain-containing protein -
  J7U08_RS00130 (J7U08_00130) - 25217..25855 (+) 639 WP_003616370.1 ATP-binding cassette domain-containing protein -
  J7U08_RS00135 (J7U08_00135) fetB 25852..26619 (+) 768 WP_002880561.1 iron export ABC transporter permease subunit FetB -
  J7U08_RS00140 (J7U08_00140) - 26622..26867 (+) 246 WP_003616368.1 hypothetical protein -
  J7U08_RS00145 (J7U08_00145) - 27083..28462 (+) 1380 WP_041812154.1 IS3-like element ISL6 family transposase -
  J7U08_RS00150 (J7U08_00150) - 28550..29704 (-) 1155 WP_138490867.1 SLAP domain-containing protein -
  J7U08_RS00155 (J7U08_00155) - 29966..30487 (+) 522 WP_003612732.1 GNAT family N-acetyltransferase -
  J7U08_RS00160 (J7U08_00160) - 30885..31718 (+) 834 WP_003612730.1 pyridoxamine kinase -
  J7U08_RS00165 (J7U08_00165) - 31754..32311 (+) 558 WP_138490868.1 ECF transporter S component -
  J7U08_RS00170 (J7U08_00170) - 32338..35103 (-) 2766 WP_016396049.1 DUF3427 domain-containing protein -
  J7U08_RS00175 (J7U08_00175) - 35252..35974 (+) 723 WP_138490869.1 DUF975 family protein -
  J7U08_RS00180 (J7U08_00180) - 36170..37495 (+) 1326 WP_138490870.1 RNA-guided endonuclease TnpB family protein -
  J7U08_RS00185 (J7U08_00185) - 38102..38581 (+) 480 WP_138490871.1 YcxB family protein -
  J7U08_RS00190 (J7U08_00190) - 38672..39100 (+) 429 WP_138490872.1 Rrf2 family transcriptional regulator -

Sequence


Protein


Download         Length: 192 a.a.        Molecular weight: 20667.31 Da        Isoelectric Point: 4.5431

>NTDB_id=553455 J7U08_RS00040 WP_003616385.1 9256..9834(+) (ssb) [Lactobacillus delbrueckii subsp. lactis strain L24754]
MINNVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNASGQREADFISCVIWRKAAENFCNFTSKGSLVGIQGRIQTR
NYDNKDGQRVYVTEVLVDNFSLLESRRERESRQQNGGFGGQGQSQNTGFNTGFGGGSGYANDNAFGSPAQSNGPANAGFN
EDNKKDAGGDTNTNPFDSSDDAINVSNDDLPF

Nucleotide


Download         Length: 579 bp        

>NTDB_id=553455 J7U08_RS00040 WP_003616385.1 9256..9834(+) (ssb) [Lactobacillus delbrueckii subsp. lactis strain L24754]
ATGATCAATAACGTTGTACTTGTTGGCCGTTTAACACGTGATCCTGAATTACGTACTACTGGGAGCGGCATCTCGGTTGC
TACGTTCACTTTGGCCGTTGACCGGCAGTTTACCAATGCATCAGGCCAGAGAGAAGCGGACTTCATCAGCTGCGTGATTT
GGCGCAAGGCTGCTGAGAACTTCTGCAACTTCACCAGCAAGGGCAGTTTGGTGGGCATCCAGGGCCGAATCCAGACCAGA
AACTATGATAACAAGGACGGCCAGCGAGTTTACGTGACAGAAGTCCTCGTGGACAACTTCTCACTGCTCGAATCACGCCG
CGAGCGTGAAAGCCGTCAGCAAAACGGCGGATTTGGCGGCCAAGGTCAAAGCCAAAACACCGGCTTCAACACCGGATTTG
GCGGCGGCAGCGGCTACGCCAACGACAACGCCTTCGGCAGCCCGGCCCAGTCAAACGGGCCAGCTAATGCCGGATTCAAT
GAAGATAACAAGAAAGATGCCGGCGGAGACACGAACACCAACCCGTTCGACAGCTCTGACGATGCAATCAACGTCTCAAA
TGACGATCTTCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I1SID3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.031

100

0.583

  ssbA Bacillus subtilis subsp. subtilis str. 168

47.396

100

0.474