Detailed information
Overview
| Name | comGE | Type | Machinery gene |
| Locus tag | LV497_RS04260 | Genome accession | NZ_CP090007 |
| Coordinates | 987756..987986 (-) | Length | 76 a.a. |
| NCBI ID | WP_002887015.1 | Uniprot ID | - |
| Organism | Streptococcus salivarius strain SALI-10 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 982756..992986
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV497_RS04225 (LV497_04225) | - | 983146..983592 (-) | 447 | WP_022496102.1 | hypothetical protein | - |
| LV497_RS04230 (LV497_04230) | - | 983670..984326 (-) | 657 | WP_002885876.1 | CPBP family intramembrane glutamic endopeptidase | - |
| LV497_RS04235 (LV497_04235) | - | 984338..984535 (-) | 198 | WP_002885716.1 | helix-turn-helix transcriptional regulator | - |
| LV497_RS04240 (LV497_04240) | - | 984786..985979 (-) | 1194 | WP_002885831.1 | acetate kinase | - |
| LV497_RS04245 (LV497_04245) | comGH | 986036..986992 (-) | 957 | WP_022496101.1 | class I SAM-dependent methyltransferase | Machinery gene |
| LV497_RS04250 (LV497_04250) | comGG | 987037..987354 (-) | 318 | WP_021144683.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LV497_RS04255 (LV497_04255) | comGF | 987332..987769 (-) | 438 | WP_022496100.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LV497_RS04260 (LV497_04260) | comGE | 987756..987986 (-) | 231 | WP_002887015.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LV497_RS04265 (LV497_04265) | comGD | 988018..988446 (-) | 429 | WP_014632541.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LV497_RS04270 (LV497_04270) | comGC | 988406..988720 (-) | 315 | WP_037611125.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LV497_RS04275 (LV497_04275) | comGB | 988729..989829 (-) | 1101 | WP_156024868.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LV497_RS04280 (LV497_04280) | comGA | 989711..990652 (-) | 942 | WP_022496097.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LV497_RS04285 (LV497_04285) | - | 990732..991094 (-) | 363 | WP_245085384.1 | DUF1033 family protein | - |
Sequence
Protein
Download Length: 76 a.a. Molecular weight: 8399.78 Da Isoelectric Point: 10.0924
>NTDB_id=553017 LV497_RS04260 WP_002887015.1 987756..987986(-) (comGE) [Streptococcus salivarius strain SALI-10]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ
Nucleotide
Download Length: 231 bp
>NTDB_id=553017 LV497_RS04260 WP_002887015.1 987756..987986(-) (comGE) [Streptococcus salivarius strain SALI-10]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACAAAACAGGATCAGTTGACCTTAAATGGGATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACAAAACAGGATCAGTTGACCTTAAATGGGATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGE | Streptococcus mutans UA140 |
39.189 |
97.368 |
0.382 |
| comGE | Streptococcus mutans UA159 |
39.189 |
97.368 |
0.382 |