Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   A7A1_RS04925 Genome accession   NC_019896
Coordinates   969757..969897 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. BSP1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 964757..974897
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A7A1_RS04900 (A7A1_2289) yueI 965052..965450 (+) 399 WP_015251331.1 YueI family protein -
  A7A1_RS04905 (A7A1_2288) pncA 965547..966098 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  A7A1_RS04910 (A7A1_2287) pncB 966114..967586 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  A7A1_RS04915 (A7A1_2286) pdeH 967723..968952 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  A7A1_RS04920 (A7A1_2285) - 968928..969296 (-) 369 WP_014477834.1 hypothetical protein -
  A7A1_RS21470 - 969410..969535 (-) 126 WP_003228793.1 hypothetical protein -
  A7A1_RS04925 (A7A1_2284) degQ 969757..969897 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  A7A1_RS04930 (A7A1_2283) comQ 970082..970981 (+) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  A7A1_RS04935 (A7A1_2282) comX 970969..971136 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  A7A1_RS04940 (A7A1_2281) comP 971151..973460 (+) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  A7A1_RS04945 (A7A1_2280) comA 973541..974185 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  A7A1_RS04950 (A7A1_2279) yuxO 974204..974584 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=55215 A7A1_RS04925 WP_003220708.1 969757..969897(+) (degQ) [Bacillus subtilis subsp. subtilis str. BSP1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=55215 A7A1_RS04925 WP_003220708.1 969757..969897(+) (degQ) [Bacillus subtilis subsp. subtilis str. BSP1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment