Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J6B42_RS15170 Genome accession   NZ_CP072311
Coordinates   3061551..3061691 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SC60     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3056551..3066691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6B42_RS15145 (J6B42_15075) - 3056897..3057280 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  J6B42_RS15150 (J6B42_15080) comA 3057302..3057946 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  J6B42_RS15155 (J6B42_15085) comP 3058027..3060327 (-) 2301 WP_226565991.1 histidine kinase Regulator
  J6B42_RS15160 (J6B42_15090) comX 3060341..3060514 (-) 174 WP_102422026.1 competence pheromone ComX -
  J6B42_RS15165 (J6B42_15095) - 3060483..3061343 (-) 861 WP_180997900.1 polyprenyl synthetase family protein -
  J6B42_RS15170 (J6B42_15100) degQ 3061551..3061691 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  J6B42_RS15175 (J6B42_15105) - 3062157..3062498 (+) 342 WP_014305721.1 hypothetical protein -
  J6B42_RS15180 (J6B42_15110) - 3062505..3063725 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  J6B42_RS15185 (J6B42_15115) - 3063855..3065321 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  J6B42_RS15190 (J6B42_15120) - 3065339..3065890 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  J6B42_RS15195 (J6B42_15125) - 3065987..3066385 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=551920 J6B42_RS15170 WP_003152043.1 3061551..3061691(-) (degQ) [Bacillus velezensis strain SC60]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=551920 J6B42_RS15170 WP_003152043.1 3061551..3061691(-) (degQ) [Bacillus velezensis strain SC60]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891