Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LUA14_RS01980 Genome accession   NZ_CP089530
Coordinates   391350..391469 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain LS1-002-014s     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 386350..396469
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUA14_RS01965 (LUA14_01965) - 387962..388645 (+) 684 WP_007410267.1 response regulator transcription factor -
  LUA14_RS01970 (LUA14_01970) - 388632..390065 (+) 1434 WP_162492834.1 sensor histidine kinase -
  LUA14_RS01975 (LUA14_01975) rapC 390218..391366 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  LUA14_RS01980 (LUA14_01980) phrC 391350..391469 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LUA14_RS01985 (LUA14_01985) - 391618..391728 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  LUA14_RS01990 (LUA14_01990) - 391808..393172 (-) 1365 WP_052827044.1 aspartate kinase -
  LUA14_RS01995 (LUA14_01995) ceuB 393586..394539 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  LUA14_RS02000 (LUA14_02000) - 394529..395476 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  LUA14_RS02005 (LUA14_02005) - 395470..396228 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=551810 LUA14_RS01980 WP_033575081.1 391350..391469(+) (phrC) [Bacillus amyloliquefaciens strain LS1-002-014s]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=551810 LUA14_RS01980 WP_033575081.1 391350..391469(+) (phrC) [Bacillus amyloliquefaciens strain LS1-002-014s]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744