Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B938_RS14670 Genome accession   NC_019842
Coordinates   3031466..3031606 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis AS43.3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3026466..3036606
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B938_RS14645 (B938_14705) - 3026792..3027175 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  B938_RS14650 (B938_14710) comA 3027197..3027841 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  B938_RS14655 (B938_14715) comP 3027922..3030228 (-) 2307 WP_015240483.1 sensor histidine kinase Regulator
  B938_RS14660 (B938_14720) comX 3030247..3030423 (-) 177 WP_015240484.1 competence pheromone ComX -
  B938_RS14665 (B938_14725) - 3030550..3031335 (-) 786 WP_227590172.1 polyprenyl synthetase family protein -
  B938_RS14670 (B938_14730) degQ 3031466..3031606 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  B938_RS14680 (B938_14740) - 3032072..3032413 (+) 342 WP_007408677.1 hypothetical protein -
  B938_RS14685 (B938_14745) - 3032420..3033643 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  B938_RS14690 (B938_14750) - 3033773..3035239 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  B938_RS14695 (B938_14755) - 3035257..3035808 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  B938_RS14700 (B938_14760) - 3035905..3036303 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=55172 B938_RS14670 WP_003152043.1 3031466..3031606(-) (degQ) [Bacillus velezensis AS43.3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=55172 B938_RS14670 WP_003152043.1 3031466..3031606(-) (degQ) [Bacillus velezensis AS43.3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment