Detailed information
Bioinformatically predicted
Overview
| Name | comEC | Type | Machinery gene |
| Locus tag | DEIPE_RS09975 | Genome accession | NC_019793 |
| Coordinates | 2037983..2038489 (-) | Length | 168 a.a. |
| NCBI ID | WP_041230823.1 | Uniprot ID | - |
| Organism | Deinococcus peraridilitoris DSM 19664 | ||
| Function | ssDNA transport through the inner membrane (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2037983..2080969 | 2037983..2038489 | within | 0 |
Gene organization within MGE regions
Location: 2037983..2080969
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DEIPE_RS09975 (Deipe_2039) | comEC | 2037983..2038489 (-) | 507 | WP_041230823.1 | hypothetical protein | Machinery gene |
| DEIPE_RS09980 (Deipe_2040) | - | 2038559..2040049 (-) | 1491 | WP_015235841.1 | recombinase family protein | - |
| DEIPE_RS23940 (Deipe_2041) | - | 2040521..2040763 (-) | 243 | WP_015235842.1 | hypothetical protein | - |
| DEIPE_RS23945 (Deipe_2042) | - | 2041014..2041358 (-) | 345 | WP_015235843.1 | hypothetical protein | - |
| DEIPE_RS09995 (Deipe_2043) | - | 2041403..2042050 (-) | 648 | WP_015235844.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DEIPE_RS22205 (Deipe_2044) | - | 2042062..2042553 (-) | 492 | WP_052326681.1 | helix-turn-helix transcriptional regulator | - |
| DEIPE_RS10005 (Deipe_2045) | - | 2042739..2042945 (+) | 207 | WP_015235846.1 | hypothetical protein | - |
| DEIPE_RS25270 (Deipe_2046) | - | 2042942..2043073 (+) | 132 | WP_015235847.1 | hypothetical protein | - |
| DEIPE_RS10010 (Deipe_2047) | - | 2043134..2043424 (+) | 291 | WP_015235848.1 | hypothetical protein | - |
| DEIPE_RS10015 (Deipe_2048) | - | 2043421..2043627 (+) | 207 | WP_015235849.1 | hypothetical protein | - |
| DEIPE_RS10020 (Deipe_2049) | - | 2043624..2043845 (+) | 222 | WP_015235850.1 | hypothetical protein | - |
| DEIPE_RS10025 (Deipe_2050) | - | 2043842..2044651 (+) | 810 | WP_015235851.1 | hypothetical protein | - |
| DEIPE_RS10030 (Deipe_2051) | - | 2044855..2045658 (+) | 804 | WP_015235852.1 | hypothetical protein | - |
| DEIPE_RS10035 (Deipe_2052) | - | 2045655..2046434 (+) | 780 | WP_015235853.1 | ATP-binding protein | - |
| DEIPE_RS10040 (Deipe_2053) | - | 2046431..2046715 (+) | 285 | WP_015235854.1 | hypothetical protein | - |
| DEIPE_RS10045 (Deipe_2054) | - | 2046712..2047272 (+) | 561 | WP_015235855.1 | hypothetical protein | - |
| DEIPE_RS10050 (Deipe_2055) | - | 2047269..2048141 (+) | 873 | WP_015235856.1 | hypothetical protein | - |
| DEIPE_RS24490 (Deipe_2056) | - | 2048219..2048395 (+) | 177 | WP_015235857.1 | hypothetical protein | - |
| DEIPE_RS10055 (Deipe_2057) | - | 2048392..2048715 (+) | 324 | WP_015235858.1 | hypothetical protein | - |
| DEIPE_RS10060 (Deipe_2058) | - | 2048715..2049131 (+) | 417 | WP_015235859.1 | MarR family transcriptional regulator | - |
| DEIPE_RS10065 (Deipe_2059) | - | 2049128..2049472 (+) | 345 | WP_015235860.1 | VRR-NUC domain-containing protein | - |
| DEIPE_RS23950 (Deipe_2060) | - | 2049469..2049627 (+) | 159 | WP_015235861.1 | hypothetical protein | - |
| DEIPE_RS10070 (Deipe_2061) | - | 2049624..2049806 (+) | 183 | WP_015235862.1 | hypothetical protein | - |
| DEIPE_RS10075 (Deipe_2062) | - | 2049803..2050345 (+) | 543 | WP_041230826.1 | hypothetical protein | - |
| DEIPE_RS10080 (Deipe_2063) | - | 2050483..2050638 (+) | 156 | WP_015235864.1 | hypothetical protein | - |
| DEIPE_RS10085 (Deipe_2064) | - | 2050635..2050838 (+) | 204 | WP_157448834.1 | hypothetical protein | - |
| DEIPE_RS10090 (Deipe_2065) | - | 2050840..2051055 (+) | 216 | WP_015235866.1 | hypothetical protein | - |
| DEIPE_RS10095 (Deipe_2066) | - | 2051065..2051577 (+) | 513 | WP_015235867.1 | terminase small subunit | - |
| DEIPE_RS10100 (Deipe_2067) | - | 2051561..2052814 (+) | 1254 | WP_015235868.1 | phage terminase large subunit | - |
| DEIPE_RS10105 (Deipe_2068) | - | 2052825..2054189 (+) | 1365 | WP_015235869.1 | hypothetical protein | - |
| DEIPE_RS22210 (Deipe_2069) | - | 2054223..2054807 (+) | 585 | WP_015235870.1 | hypothetical protein | - |
| DEIPE_RS10115 (Deipe_2070) | - | 2054821..2055642 (+) | 822 | WP_015235871.1 | P22 phage major capsid protein family protein | - |
| DEIPE_RS23955 (Deipe_2071) | - | 2055647..2055790 (+) | 144 | WP_015235872.1 | hypothetical protein | - |
| DEIPE_RS10120 (Deipe_2072) | - | 2055799..2056191 (+) | 393 | WP_015235873.1 | hypothetical protein | - |
| DEIPE_RS10125 (Deipe_2073) | - | 2056193..2056582 (+) | 390 | WP_015235874.1 | hypothetical protein | - |
| DEIPE_RS10130 (Deipe_2074) | - | 2056586..2056984 (+) | 399 | WP_015235875.1 | hypothetical protein | - |
| DEIPE_RS10135 (Deipe_2075) | - | 2056981..2057358 (+) | 378 | WP_015235876.1 | hypothetical protein | - |
| DEIPE_RS10140 (Deipe_2076) | - | 2057361..2057597 (+) | 237 | WP_015235877.1 | hypothetical protein | - |
| DEIPE_RS10145 (Deipe_2077) | - | 2057601..2058086 (+) | 486 | WP_015235878.1 | hypothetical protein | - |
| DEIPE_RS10150 (Deipe_2078) | - | 2058086..2058301 (+) | 216 | WP_015235879.1 | hypothetical protein | - |
| DEIPE_RS10155 (Deipe_2079) | - | 2058301..2058669 (+) | 369 | WP_015235880.1 | hypothetical protein | - |
| DEIPE_RS10160 (Deipe_2080) | - | 2058687..2059148 (+) | 462 | WP_015235881.1 | hypothetical protein | - |
| DEIPE_RS10165 (Deipe_2081) | - | 2059175..2059516 (+) | 342 | WP_157448835.1 | hypothetical protein | - |
| DEIPE_RS10170 (Deipe_2082) | - | 2059579..2065878 (+) | 6300 | WP_015235883.1 | phage tail tape measure protein | - |
| DEIPE_RS10175 (Deipe_2083) | - | 2065977..2067581 (+) | 1605 | WP_015235884.1 | hypothetical protein | - |
| DEIPE_RS24495 (Deipe_2084) | - | 2067578..2068096 (+) | 519 | WP_015235885.1 | hypothetical protein | - |
| DEIPE_RS10185 (Deipe_2085) | - | 2068105..2068617 (+) | 513 | WP_015235886.1 | hypothetical protein | - |
| DEIPE_RS10190 (Deipe_2086) | - | 2068626..2070695 (+) | 2070 | WP_015235887.1 | SGNH/GDSL hydrolase family protein | - |
| DEIPE_RS10195 (Deipe_2087) | - | 2070912..2071997 (+) | 1086 | WP_015235888.1 | SGNH/GDSL hydrolase family protein | - |
| DEIPE_RS10200 (Deipe_2088) | - | 2072082..2072477 (+) | 396 | WP_015235889.1 | hypothetical protein | - |
| DEIPE_RS10205 (Deipe_2089) | - | 2072474..2072887 (+) | 414 | WP_041230829.1 | hypothetical protein | - |
| DEIPE_RS10210 (Deipe_2090) | - | 2072884..2073309 (+) | 426 | WP_015235890.1 | M15 family metallopeptidase | - |
| DEIPE_RS22215 (Deipe_2091) | - | 2073318..2075441 (+) | 2124 | WP_015235891.1 | Ig-like domain-containing protein | - |
| DEIPE_RS10220 (Deipe_2092) | - | 2075480..2075992 (+) | 513 | WP_015235892.1 | hypothetical protein | - |
| DEIPE_RS10225 (Deipe_2093) | - | 2076062..2076562 (+) | 501 | WP_015235893.1 | hypothetical protein | - |
| DEIPE_RS22220 (Deipe_2094) | - | 2076807..2077739 (+) | 933 | WP_015235894.1 | site-specific integrase | - |
| DEIPE_RS10235 (Deipe_2095) | - | 2077791..2077973 (-) | 183 | WP_015235895.1 | hypothetical protein | - |
| DEIPE_RS23965 (Deipe_2096) | - | 2078256..2078432 (-) | 177 | WP_015235896.1 | zf-TFIIB domain-containing protein | - |
| DEIPE_RS10240 (Deipe_2097) | - | 2078446..2078667 (-) | 222 | WP_015235897.1 | hypothetical protein | - |
| DEIPE_RS10245 (Deipe_2098) | - | 2078684..2079004 (-) | 321 | WP_015235898.1 | hypothetical protein | - |
| DEIPE_RS10250 (Deipe_2099) | - | 2079012..2079263 (-) | 252 | WP_015235899.1 | hypothetical protein | - |
| DEIPE_RS10255 (Deipe_2100) | - | 2079277..2079468 (-) | 192 | WP_015235900.1 | hypothetical protein | - |
| DEIPE_RS10260 (Deipe_2101) | - | 2079765..2080223 (-) | 459 | WP_015235901.1 | DUF5662 family protein | - |
| DEIPE_RS10265 (Deipe_2102) | - | 2080250..2080969 (-) | 720 | WP_015235902.1 | DNA cytosine methyltransferase | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18819.40 Da Isoelectric Point: 6.2276
>NTDB_id=55089 DEIPE_RS09975 WP_041230823.1 2037983..2038489(-) (comEC) [Deinococcus peraridilitoris DSM 19664]
MLRLLPVGELWIGHRADDPVLHELLRAARERDVPVREVRRGDSLTVEDATFTVLWPQGVPWSSKDNENSVVVKLQDRGFR
TVFLGDIPAPLEDLLGIGEVDLLKVAHHGSRFSTGEMLLNETSPPDAVISLGRNTYGHPSQEVLARLQTHGVRVWRTDQQ
GAVRWPLP
MLRLLPVGELWIGHRADDPVLHELLRAARERDVPVREVRRGDSLTVEDATFTVLWPQGVPWSSKDNENSVVVKLQDRGFR
TVFLGDIPAPLEDLLGIGEVDLLKVAHHGSRFSTGEMLLNETSPPDAVISLGRNTYGHPSQEVLARLQTHGVRVWRTDQQ
GAVRWPLP
Nucleotide
Download Length: 507 bp
>NTDB_id=55089 DEIPE_RS09975 WP_041230823.1 2037983..2038489(-) (comEC) [Deinococcus peraridilitoris DSM 19664]
GTGCTGCGGTTGCTGCCGGTGGGCGAGCTGTGGATCGGACATCGCGCCGACGACCCGGTACTGCACGAACTGCTGCGAGC
CGCGCGTGAGCGGGACGTGCCGGTGCGCGAGGTGCGGCGTGGCGACTCGCTGACGGTGGAGGACGCGACCTTCACCGTGC
TGTGGCCCCAGGGCGTACCGTGGAGCTCGAAGGACAACGAGAACAGCGTGGTGGTGAAGCTGCAAGACCGCGGGTTTCGC
ACGGTGTTTCTGGGAGACATACCCGCCCCGCTGGAGGATCTCCTGGGCATCGGAGAGGTCGACCTTCTGAAGGTCGCGCA
CCATGGCTCGCGCTTCTCGACGGGTGAAATGTTGCTGAACGAGACCTCACCGCCAGACGCGGTGATTTCGCTCGGTCGGA
ACACCTATGGCCATCCCAGCCAAGAGGTACTTGCGCGTCTGCAGACGCACGGCGTCCGGGTGTGGCGTACCGATCAGCAG
GGCGCGGTGCGCTGGCCCCTGCCTTGA
GTGCTGCGGTTGCTGCCGGTGGGCGAGCTGTGGATCGGACATCGCGCCGACGACCCGGTACTGCACGAACTGCTGCGAGC
CGCGCGTGAGCGGGACGTGCCGGTGCGCGAGGTGCGGCGTGGCGACTCGCTGACGGTGGAGGACGCGACCTTCACCGTGC
TGTGGCCCCAGGGCGTACCGTGGAGCTCGAAGGACAACGAGAACAGCGTGGTGGTGAAGCTGCAAGACCGCGGGTTTCGC
ACGGTGTTTCTGGGAGACATACCCGCCCCGCTGGAGGATCTCCTGGGCATCGGAGAGGTCGACCTTCTGAAGGTCGCGCA
CCATGGCTCGCGCTTCTCGACGGGTGAAATGTTGCTGAACGAGACCTCACCGCCAGACGCGGTGATTTCGCTCGGTCGGA
ACACCTATGGCCATCCCAGCCAAGAGGTACTTGCGCGTCTGCAGACGCACGGCGTCCGGGTGTGGCGTACCGATCAGCAG
GGCGCGGTGCGCTGGCCCCTGCCTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEC | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
58.48 |
100 |
0.595 |
| comA/comEC | Thermus thermophilus HB27 |
44.056 |
85.119 |
0.375 |
| comEC | Bacillus subtilis subsp. subtilis str. 168 |
39.869 |
91.071 |
0.363 |