Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J5X95_RS04580 Genome accession   NZ_CP072120
Coordinates   894206..894346 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain GKT04     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 889206..899346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5X95_RS04555 (J5X95_04555) - 889552..889935 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  J5X95_RS04560 (J5X95_04560) comA 889957..890601 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  J5X95_RS04565 (J5X95_04565) comP 890682..892982 (-) 2301 WP_219371653.1 histidine kinase Regulator
  J5X95_RS04570 (J5X95_04570) comX 892996..893169 (-) 174 WP_012118314.1 competence pheromone ComX -
  J5X95_RS04575 (J5X95_04575) - 893138..893998 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  J5X95_RS04580 (J5X95_04580) degQ 894206..894346 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  J5X95_RS04585 (J5X95_04585) - 894809..895150 (+) 342 WP_007408677.1 hypothetical protein -
  J5X95_RS04590 (J5X95_04590) - 895157..896380 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  J5X95_RS04595 (J5X95_04595) - 896510..897976 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  J5X95_RS04600 (J5X95_04600) - 897994..898545 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  J5X95_RS04605 (J5X95_04605) - 898642..899040 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=550699 J5X95_RS04580 WP_003152043.1 894206..894346(-) (degQ) [Bacillus amyloliquefaciens strain GKT04]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=550699 J5X95_RS04580 WP_003152043.1 894206..894346(-) (degQ) [Bacillus amyloliquefaciens strain GKT04]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891