Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   J3R86_RS09215 Genome accession   NZ_CP071589
Coordinates   2002626..2003021 (-) Length   131 a.a.
NCBI ID   WP_207517044.1    Uniprot ID   -
Organism   Staphylococcus simiae strain 17941E     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1994257..2022405 2002626..2003021 within 0


Gene organization within MGE regions


Location: 1994257..2022405
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J3R86_RS09175 (J3R86_09175) - 1994257..1994907 (+) 651 WP_207517038.1 HD domain-containing protein -
  J3R86_RS09180 (J3R86_09180) - 1995235..1996953 (+) 1719 Protein_1771 IS1182 family transposase -
  J3R86_RS09185 (J3R86_09185) yidC 1996923..1997789 (-) 867 WP_207517039.1 membrane protein insertase YidC -
  J3R86_RS09190 (J3R86_09190) thiE 1997875..1998519 (-) 645 WP_207517040.1 thiamine phosphate synthase -
  J3R86_RS09195 (J3R86_09195) thiM 1998519..1999310 (-) 792 WP_207518542.1 hydroxyethylthiazole kinase -
  J3R86_RS09200 (J3R86_09200) thiD 1999297..2000124 (-) 828 WP_207517041.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  J3R86_RS09205 (J3R86_09205) tenA 2000117..2000806 (-) 690 WP_207517042.1 thiaminase II -
  J3R86_RS09210 (J3R86_09210) - 2001228..2002010 (-) 783 WP_207517043.1 transglycosylase family protein -
  J3R86_RS09215 (J3R86_09215) ssb 2002626..2003021 (-) 396 WP_207517044.1 single-stranded DNA-binding protein Machinery gene
  J3R86_RS09220 (J3R86_09220) - 2003215..2003655 (+) 441 WP_207517045.1 YwpF-like family protein -
  J3R86_RS09225 (J3R86_09225) fabZ 2003708..2004148 (-) 441 WP_002464819.1 3-hydroxyacyl-ACP dehydratase FabZ -
  J3R86_RS09230 (J3R86_09230) murA 2004184..2005449 (-) 1266 WP_207517046.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  J3R86_RS09235 (J3R86_09235) - 2005568..2005801 (-) 234 WP_002464817.1 DUF1146 family protein -
  J3R86_RS09240 (J3R86_09240) - 2006532..2007528 (+) 997 Protein_1783 transposase -
  J3R86_RS09245 (J3R86_09245) - 2007520..2007924 (-) 405 WP_207517047.1 F0F1 ATP synthase subunit epsilon -
  J3R86_RS09250 (J3R86_09250) atpD 2007943..2009355 (-) 1413 WP_207517048.1 F0F1 ATP synthase subunit beta -
  J3R86_RS09255 (J3R86_09255) atpG 2009377..2010243 (-) 867 WP_207517049.1 ATP synthase F1 subunit gamma -
  J3R86_RS09260 (J3R86_09260) atpA 2010274..2011782 (-) 1509 WP_207517050.1 F0F1 ATP synthase subunit alpha -
  J3R86_RS09265 (J3R86_09265) - 2011804..2012343 (-) 540 WP_207517051.1 F0F1 ATP synthase subunit delta -
  J3R86_RS09270 (J3R86_09270) - 2012343..2012864 (-) 522 WP_207517052.1 F0F1 ATP synthase subunit B -
  J3R86_RS09275 (J3R86_09275) atpE 2012962..2013174 (-) 213 WP_001048816.1 F0F1 ATP synthase subunit C -
  J3R86_RS09280 (J3R86_09280) atpB 2013218..2013946 (-) 729 WP_002464810.1 F0F1 ATP synthase subunit A -
  J3R86_RS09285 (J3R86_09285) - 2013967..2014370 (-) 404 Protein_1792 ATP synthase subunit I -
  J3R86_RS09290 (J3R86_09290) wecB 2014484..2015614 (-) 1131 WP_207518543.1 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) -
  J3R86_RS09295 (J3R86_09295) upp 2015638..2016267 (-) 630 WP_207517054.1 uracil phosphoribosyltransferase -
  J3R86_RS09300 (J3R86_09300) glyA 2016293..2017531 (-) 1239 WP_207517055.1 serine hydroxymethyltransferase -
  J3R86_RS09305 (J3R86_09305) - 2017558..2018082 (-) 525 WP_207517056.1 TIGR01440 family protein -
  J3R86_RS09310 (J3R86_09310) - 2018175..2018609 (-) 435 WP_207517057.1 low molecular weight protein arginine phosphatase -
  J3R86_RS09315 (J3R86_09315) - 2018606..2019652 (-) 1047 WP_207517058.1 L-threonylcarbamoyladenylate synthase -
  J3R86_RS09320 (J3R86_09320) prmC 2019907..2020743 (-) 837 WP_207517059.1 peptide chain release factor N(5)-glutamine methyltransferase -
  J3R86_RS09325 (J3R86_09325) prfA 2020730..2021806 (-) 1077 WP_207517060.1 peptide chain release factor 1 -
  J3R86_RS09330 (J3R86_09330) - 2021806..2022405 (-) 600 WP_207517061.1 thymidine kinase -

Sequence

Protein


Download         Length: 131 a.a.        Molecular weight: 15123.10 Da        Isoelectric Point: 4.7789

>NTDB_id=546743 J3R86_RS09215 WP_207517044.1 2002626..2003021(-) (ssb) [Staphylococcus simiae strain 17941E]
MLNKIVIVGRLTKDVQLFDKEDSKIATFCVATQRNYKDENDEFVSDYIFCKAFGKLAVNIEKYTNQGSLVGITGQMRSRK
YVKDEQTHFVTELYVETIKFMSPKSKNDEILSDNAYDINSNNIDNPDFLEI

Nucleotide


Download         Length: 396 bp        

>NTDB_id=546743 J3R86_RS09215 WP_207517044.1 2002626..2003021(-) (ssb) [Staphylococcus simiae strain 17941E]
ATGTTAAACAAAATCGTCATAGTCGGAAGACTAACCAAAGATGTACAACTATTTGACAAGGAGGATAGTAAAATAGCAAC
ATTTTGTGTTGCAACACAAAGAAATTATAAAGACGAAAATGATGAGTTTGTAAGTGATTATATTTTTTGTAAAGCTTTTG
GTAAATTGGCAGTAAATATTGAAAAATATACAAACCAAGGTTCATTAGTCGGCATAACCGGCCAAATGCGTTCACGAAAA
TATGTCAAAGATGAACAAACACATTTTGTAACTGAATTATATGTTGAAACGATTAAATTTATGTCCCCTAAATCTAAAAA
TGATGAAATTCTTTCAGATAATGCTTATGATATCAACTCCAATAATATAGACAATCCTGACTTTCTAGAAATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Staphylococcus aureus N315

83.206

100

0.832
  ssb Staphylococcus aureus MW2

82.443

100

0.824