Detailed information
Bioinformatically predicted
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | UC509_RS13705 | Genome accession | NC_019435 |
| Coordinates | 2074508..2074696 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris subsp. cremoris UC509.9 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2069508..2079696
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UC509_RS10505 (uc509_2094) | - | 2070434..2071243 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| UC509_RS10510 (uc509_2095) | - | 2071236..2071973 (-) | 738 | WP_015082929.1 | metal ABC transporter ATP-binding protein | - |
| UC509_RS10515 (uc509_2096) | - | 2072152..2072994 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| UC509_RS10520 (uc509_2097) | - | 2072991..2073428 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| UC509_RS10525 (uc509_2098) | comGG | 2073508..2073807 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| UC509_RS10530 (uc509_2099) | comGF | 2073831..2074256 (-) | 426 | WP_373467301.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UC509_RS10535 (uc509_2100) | comGE | 2074240..2074476 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| UC509_RS13705 | comGD | 2074508..2074696 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| UC509_RS10545 (uc509_2102) | comGC | 2074898..2075248 (-) | 351 | WP_051013201.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UC509_RS10550 (uc509_2103) | comGB | 2075293..2076318 (-) | 1026 | WP_051013189.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UC509_RS10555 (uc509_2104) | comGA | 2076218..2077198 (-) | 981 | WP_015082934.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=54492 UC509_RS13705 WP_014573336.1 2074508..2074696(-) (comGD) [Lactococcus cremoris subsp. cremoris UC509.9]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=54492 UC509_RS13705 WP_014573336.1 2074508..2074696(-) (comGD) [Lactococcus cremoris subsp. cremoris UC509.9]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |