Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   JW886_RS00345 Genome accession   NZ_CP070872
Coordinates   56373..56672 (-) Length   99 a.a.
NCBI ID   WP_205872026.1    Uniprot ID   A0AA45QRH2
Organism   Lactococcus taiwanensis strain K_LL004     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 51373..61672
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JW886_RS00310 (JW886_00310) - 51555..52439 (+) 885 WP_205872023.1 RluA family pseudouridine synthase -
  JW886_RS00315 (JW886_00315) - 52500..53309 (-) 810 WP_205872024.1 metal ABC transporter permease -
  JW886_RS00320 (JW886_00320) - 53302..54039 (-) 738 WP_200407574.1 metal ABC transporter ATP-binding protein -
  JW886_RS00325 (JW886_00325) - 54249..55091 (-) 843 WP_075525594.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  JW886_RS00330 (JW886_00330) - 55107..55559 (-) 453 WP_200407576.1 zinc-dependent MarR family transcriptional regulator -
  JW886_RS00335 (JW886_00335) comGG 55638..55949 (-) 312 WP_205872025.1 competence type IV pilus minor pilin ComGG -
  JW886_RS00340 (JW886_00340) comGF 55961..56392 (-) 432 WP_241003773.1 competence type IV pilus minor pilin ComGF Machinery gene
  JW886_RS00345 (JW886_00345) comGE 56373..56672 (-) 300 WP_205872026.1 competence type IV pilus minor pilin ComGE Machinery gene
  JW886_RS00350 (JW886_00350) comGD 56644..57087 (-) 444 WP_241003774.1 competence type IV pilus minor pilin ComGD Machinery gene
  JW886_RS00355 (JW886_00355) comGC 57035..57391 (-) 357 WP_420844222.1 competence type IV pilus major pilin ComGC Machinery gene
  JW886_RS00360 (JW886_00360) comGB 57405..58421 (-) 1017 WP_205872463.1 competence type IV pilus assembly protein ComGB Machinery gene
  JW886_RS00365 (JW886_00365) comGA 58345..59328 (-) 984 WP_205872028.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11084.83 Da        Isoelectric Point: 5.8598

>NTDB_id=541185 JW886_RS00345 WP_205872026.1 56373..56672(-) (comGE) [Lactococcus taiwanensis strain K_LL004]
MENLKKKSVRAYLLLESLITLGLLGILVTSVLTEVVKSRQQLQEDNQQIEALNVAKMALNTRLTELSVNGASIKVEQTDD
QISITNRGKELLELERTPH

Nucleotide


Download         Length: 300 bp        

>NTDB_id=541185 JW886_RS00345 WP_205872026.1 56373..56672(-) (comGE) [Lactococcus taiwanensis strain K_LL004]
GTGGAAAATTTAAAAAAGAAGTCAGTTAGAGCTTATTTACTCTTAGAAAGTTTAATAACGCTGGGTTTGCTGGGTATCTT
AGTCACAAGTGTTTTGACAGAAGTTGTGAAGAGTCGTCAACAACTGCAAGAGGATAATCAACAGATTGAAGCATTGAATG
TTGCGAAGATGGCATTAAATACTCGCCTGACGGAGTTATCAGTAAATGGTGCTTCAATTAAAGTTGAACAAACTGATGAC
CAAATTTCTATAACAAATAGGGGAAAGGAGCTTTTAGAACTTGAGAGGACACCGCATTAG

Domains

Predicted by InterproScan.

Type II secretory pathway pseudopilin (ComGE)

(13-94)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

53.684

95.96

0.515