Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   JOW61_RS12760 Genome accession   NZ_CP070844
Coordinates   2373441..2373815 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. natto strain BN0     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2368441..2378815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JOW61_RS12720 (JOW61_12610) yqhG 2368773..2369567 (+) 795 WP_014480249.1 YqhG family protein -
  JOW61_RS12725 (JOW61_12615) sinI 2369750..2369923 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  JOW61_RS12730 (JOW61_12620) sinR 2369957..2370292 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JOW61_RS12735 (JOW61_12625) tasA 2370385..2371170 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  JOW61_RS12740 (JOW61_12630) sipW 2371234..2371806 (-) 573 WP_003230181.1 signal peptidase I -
  JOW61_RS12745 (JOW61_12635) tapA 2371790..2372551 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  JOW61_RS12750 (JOW61_12640) yqzG 2372823..2373149 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JOW61_RS12755 (JOW61_12645) spoIIT 2373191..2373370 (-) 180 WP_014480252.1 YqzE family protein -
  JOW61_RS12760 (JOW61_12650) comGG 2373441..2373815 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JOW61_RS12765 (JOW61_12655) comGF 2373816..2374199 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  JOW61_RS12770 (JOW61_12660) comGE 2374225..2374572 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  JOW61_RS12775 (JOW61_12665) comGD 2374556..2374987 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  JOW61_RS12780 (JOW61_12670) comGC 2374977..2375273 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  JOW61_RS12785 (JOW61_12675) comGB 2375287..2376324 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  JOW61_RS12790 (JOW61_12680) comGA 2376311..2377381 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  JOW61_RS12795 (JOW61_12685) - 2377593..2377790 (-) 198 WP_014480259.1 CBS domain-containing protein -
  JOW61_RS12800 (JOW61_12690) corA 2377792..2378745 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=541002 JOW61_RS12760 WP_014480253.1 2373441..2373815(-) (comGG) [Bacillus subtilis subsp. natto strain BN0]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=541002 JOW61_RS12760 WP_014480253.1 2373441..2373815(-) (comGG) [Bacillus subtilis subsp. natto strain BN0]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976