Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   JQX68_RS12650 Genome accession   NZ_CP070483
Coordinates   2498741..2499088 (-) Length   115 a.a.
NCBI ID   WP_147772233.1    Uniprot ID   -
Organism   Bacillus sp. LJBS06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2493741..2504088
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQX68_RS12605 (JQX68_12605) sinI 2494274..2494447 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  JQX68_RS12610 (JQX68_12610) sinR 2494481..2494816 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JQX68_RS12615 (JQX68_12615) tasA 2494910..2495695 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JQX68_RS12620 (JQX68_12620) - 2495759..2496331 (-) 573 WP_147772443.1 signal peptidase I -
  JQX68_RS12625 (JQX68_12625) tapA 2496315..2497070 (-) 756 WP_147772231.1 amyloid fiber anchoring/assembly protein TapA -
  JQX68_RS12630 (JQX68_12630) - 2497342..2497668 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  JQX68_RS12635 (JQX68_12635) - 2497709..2497888 (-) 180 WP_014480252.1 YqzE family protein -
  JQX68_RS12640 (JQX68_12640) comGG 2497960..2498334 (-) 375 WP_147772232.1 competence type IV pilus minor pilin ComGG Machinery gene
  JQX68_RS12645 (JQX68_12645) comGF 2498335..2498715 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  JQX68_RS12650 (JQX68_12650) comGE 2498741..2499088 (-) 348 WP_147772233.1 competence type IV pilus minor pilin ComGE Machinery gene
  JQX68_RS12655 (JQX68_12655) comGD 2499072..2499503 (-) 432 WP_147772234.1 competence type IV pilus minor pilin ComGD Machinery gene
  JQX68_RS12660 (JQX68_12660) comGC 2499493..2499789 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  JQX68_RS12665 (JQX68_12665) comGB 2499803..2500840 (-) 1038 WP_147772235.1 competence type IV pilus assembly protein ComGB Machinery gene
  JQX68_RS12670 (JQX68_12670) comGA 2500827..2501897 (-) 1071 WP_040082636.1 competence protein ComGA Machinery gene
  JQX68_RS12675 (JQX68_12675) - 2502110..2502520 (-) 411 WP_147772236.1 CBS domain-containing protein -
  JQX68_RS12680 (JQX68_12680) corA 2502583..2503536 (-) 954 WP_103030653.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13118.05 Da        Isoelectric Point: 4.6486

>NTDB_id=540017 JQX68_RS12650 WP_147772233.1 2498741..2499088(-) (comGE) [Bacillus sp. LJBS06]
MWIGSKGFSTIETMSALSLWLFVLLTVVPLWDKLIADENMAESREIGYQMMNERISKYVMTGEGAASKTMTKNNHTYAMT
WEEEGEYQNVCISAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=540017 JQX68_RS12650 WP_147772233.1 2498741..2499088(-) (comGE) [Bacillus sp. LJBS06]
ATGTGGATAGGAAGTAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTATGGCTGTTTGTGCTGCTGACAGT
TGTTCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGGCGGAATCACGAGAAATCGGTTATCAGATGATGAATGAGA
GAATTAGCAAATATGTCATGACTGGTGAAGGAGCCGCGTCAAAAACGATGACAAAGAACAACCATACCTATGCTATGACG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGCATCTCAGCGGCAGCTTATAAAGAAAAATCATTTTGCCTCAGCATTCT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

90.435

100

0.904