Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JQX68_RS12605 Genome accession   NZ_CP070483
Coordinates   2494274..2494447 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. LJBS06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2489274..2499447
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQX68_RS12590 (JQX68_12590) gcvT 2490072..2491160 (-) 1089 WP_147772230.1 glycine cleavage system aminomethyltransferase GcvT -
  JQX68_RS12595 (JQX68_12595) - 2491602..2493275 (+) 1674 WP_069149860.1 SNF2-related protein -
  JQX68_RS12600 (JQX68_12600) - 2493296..2494090 (+) 795 WP_069839479.1 YqhG family protein -
  JQX68_RS12605 (JQX68_12605) sinI 2494274..2494447 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  JQX68_RS12610 (JQX68_12610) sinR 2494481..2494816 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JQX68_RS12615 (JQX68_12615) tasA 2494910..2495695 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JQX68_RS12620 (JQX68_12620) - 2495759..2496331 (-) 573 WP_147772443.1 signal peptidase I -
  JQX68_RS12625 (JQX68_12625) tapA 2496315..2497070 (-) 756 WP_147772231.1 amyloid fiber anchoring/assembly protein TapA -
  JQX68_RS12630 (JQX68_12630) - 2497342..2497668 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  JQX68_RS12635 (JQX68_12635) - 2497709..2497888 (-) 180 WP_014480252.1 YqzE family protein -
  JQX68_RS12640 (JQX68_12640) comGG 2497960..2498334 (-) 375 WP_147772232.1 competence type IV pilus minor pilin ComGG Machinery gene
  JQX68_RS12645 (JQX68_12645) comGF 2498335..2498715 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  JQX68_RS12650 (JQX68_12650) comGE 2498741..2499088 (-) 348 WP_147772233.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=540013 JQX68_RS12605 WP_003230187.1 2494274..2494447(+) (sinI) [Bacillus sp. LJBS06]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=540013 JQX68_RS12605 WP_003230187.1 2494274..2494447(+) (sinI) [Bacillus sp. LJBS06]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1