Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LJA36_RS07420 Genome accession   NZ_CP085282
Coordinates   1582183..1582302 (-) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain TPS17     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1577183..1587302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA36_RS07395 - 1577424..1578182 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  LJA36_RS07400 - 1578176..1579123 (-) 948 WP_040238557.1 iron chelate uptake ABC transporter family permease subunit -
  LJA36_RS07405 ceuB 1579113..1580066 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  LJA36_RS07410 - 1580480..1581844 (+) 1365 WP_015416811.1 aspartate kinase -
  LJA36_RS07415 - 1581939..1582034 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  LJA36_RS07420 phrC 1582183..1582302 (-) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LJA36_RS07425 rapC 1582286..1583434 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  LJA36_RS07430 - 1583576..1585009 (-) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  LJA36_RS07435 - 1584996..1585679 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=538075 LJA36_RS07420 WP_031378677.1 1582183..1582302(-) (phrC) [Bacillus amyloliquefaciens strain TPS17]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=538075 LJA36_RS07420 WP_031378677.1 1582183..1582302(-) (phrC) [Bacillus amyloliquefaciens strain TPS17]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769