Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   I6K93_RS04135 Genome accession   NZ_CP069951
Coordinates   824677..825549 (+) Length   290 a.a.
NCBI ID   WP_002484839.1    Uniprot ID   A0A4Y7VXK4
Organism   Staphylococcus epidermidis strain FDAARGOS_1363     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 789027..859209 824677..825549 within 0


Gene organization within MGE regions


Location: 789027..859209
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6K93_RS03990 (I6K93_03995) - 790114..790857 (+) 744 WP_002439460.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  I6K93_RS03995 (I6K93_04000) pknB 790854..792857 (+) 2004 WP_002439462.1 Stk1 family PASTA domain-containing Ser/Thr kinase -
  I6K93_RS04000 (I6K93_04005) rsgA 793165..794040 (+) 876 WP_002456227.1 ribosome small subunit-dependent GTPase A -
  I6K93_RS04005 (I6K93_04010) rpe 794041..794685 (+) 645 WP_001830173.1 ribulose-phosphate 3-epimerase -
  I6K93_RS04010 (I6K93_04015) - 794690..795325 (+) 636 WP_002489340.1 thiamine diphosphokinase -
  I6K93_RS04015 (I6K93_04020) rpmB 795408..795596 (-) 189 WP_001830107.1 50S ribosomal protein L28 -
  I6K93_RS04020 (I6K93_04025) - 795954..796328 (+) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  I6K93_RS04025 (I6K93_04030) fakA 796343..798001 (+) 1659 WP_002489351.1 fatty acid kinase catalytic subunit FakA -
  I6K93_RS04030 (I6K93_04035) recG 798205..800253 (+) 2049 WP_020368084.1 ATP-dependent DNA helicase RecG -
  I6K93_RS04035 (I6K93_04040) fapR 800412..800972 (+) 561 WP_001830099.1 transcription factor FapR -
  I6K93_RS04040 (I6K93_04045) plsX 800974..801951 (+) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  I6K93_RS04045 (I6K93_04050) fabD 801953..802879 (+) 927 WP_001830062.1 ACP S-malonyltransferase -
  I6K93_RS04050 (I6K93_04055) fabG 802872..803606 (+) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  I6K93_RS04055 (I6K93_04060) - 803833..804066 (+) 234 WP_001830184.1 acyl carrier protein -
  I6K93_RS04060 (I6K93_04065) rnc 804181..804918 (+) 738 WP_002470220.1 ribonuclease III -
  I6K93_RS04065 (I6K93_04070) smc 805045..808614 (+) 3570 WP_002502436.1 chromosome segregation protein SMC -
  I6K93_RS04070 (I6K93_04075) ftsY 808611..809837 (+) 1227 WP_001830080.1 signal recognition particle-docking protein FtsY -
  I6K93_RS04075 (I6K93_04080) - 809839..810171 (+) 333 WP_002457379.1 putative DNA-binding protein -
  I6K93_RS04080 (I6K93_04085) ffh 810202..811569 (+) 1368 WP_001830113.1 signal recognition particle protein -
  I6K93_RS04085 (I6K93_04090) rpsP 811877..812152 (+) 276 WP_002439483.1 30S ribosomal protein S16 -
  I6K93_RS04090 (I6K93_04095) rimM 812279..812782 (+) 504 WP_001832559.1 ribosome maturation factor RimM -
  I6K93_RS04095 (I6K93_04100) trmD 812782..813519 (+) 738 WP_049400206.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  I6K93_RS04100 (I6K93_04105) rplS 813625..813975 (+) 351 WP_002436293.1 50S ribosomal protein L19 -
  I6K93_RS04105 (I6K93_04110) - 814505..817108 (-) 2604 WP_020368058.1 YfhO family protein -
  I6K93_RS04110 (I6K93_04115) - 817101..819701 (-) 2601 WP_010959172.1 YfhO family protein -
  I6K93_RS04115 (I6K93_04125) ylqF 820030..820893 (+) 864 WP_002468554.1 ribosome biogenesis GTPase YlqF -
  I6K93_RS04120 (I6K93_04130) - 820898..821668 (+) 771 WP_001829514.1 ribonuclease HII -
  I6K93_RS04125 (I6K93_04135) sucC 821776..822942 (+) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  I6K93_RS04130 (I6K93_04140) sucD 822964..823872 (+) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  I6K93_RS12090 - 824122..824337 (+) 216 Protein_802 transposase -
  I6K93_RS04135 (I6K93_04145) dprA 824677..825549 (+) 873 WP_002484839.1 DNA-processing protein DprA Machinery gene
  I6K93_RS04140 (I6K93_04150) topA 825732..827801 (+) 2070 WP_001829508.1 type I DNA topoisomerase -
  I6K93_RS04145 (I6K93_04155) trmFO 827826..829133 (+) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  I6K93_RS04150 (I6K93_04160) xerC 829358..830248 (+) 891 WP_002456225.1 tyrosine recombinase XerC -
  I6K93_RS04155 (I6K93_04165) hslV 830252..830794 (+) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  I6K93_RS04160 (I6K93_04170) hslU 830863..832266 (+) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  I6K93_RS04165 (I6K93_04175) codY 832290..833060 (+) 771 WP_002439506.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  I6K93_RS04170 (I6K93_04180) rpsB 833423..834211 (+) 789 WP_001832557.1 30S ribosomal protein S2 -
  I6K93_RS04175 (I6K93_04185) tsf 834363..835241 (+) 879 WP_002439509.1 translation elongation factor Ts -
  I6K93_RS04180 (I6K93_04190) pyrH 835382..836104 (+) 723 WP_002439511.1 UMP kinase -
  I6K93_RS04185 (I6K93_04195) frr 836121..836675 (+) 555 WP_001829472.1 ribosome recycling factor -
  I6K93_RS04190 (I6K93_04200) - 836896..837666 (+) 771 WP_001832561.1 isoprenyl transferase -
  I6K93_RS04195 (I6K93_04205) - 837670..838452 (+) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  I6K93_RS04200 (I6K93_04210) rseP 838686..839972 (+) 1287 WP_001829501.1 RIP metalloprotease RseP -
  I6K93_RS04205 (I6K93_04215) - 839991..841694 (+) 1704 WP_001829513.1 proline--tRNA ligase -
  I6K93_RS04210 (I6K93_04220) - 841944..846254 (+) 4311 WP_099833848.1 PolC-type DNA polymerase III -
  I6K93_RS04215 (I6K93_04225) rimP 846433..846900 (+) 468 WP_002439519.1 ribosome maturation factor RimP -
  I6K93_RS04220 (I6K93_04230) nusA 846921..848144 (+) 1224 WP_001829457.1 transcription termination factor NusA -
  I6K93_RS04225 (I6K93_04235) - 848162..848446 (+) 285 WP_001829465.1 YlxR family protein -
  I6K93_RS04230 (I6K93_04240) - 848446..848763 (+) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  I6K93_RS04235 (I6K93_04245) infB 848768..850930 (+) 2163 WP_002456223.1 translation initiation factor IF-2 -
  I6K93_RS04240 (I6K93_04250) rbfA 851233..851583 (+) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  I6K93_RS04245 (I6K93_04255) truB 851721..852638 (+) 918 WP_002439525.1 tRNA pseudouridine(55) synthase TruB -
  I6K93_RS04250 (I6K93_04260) - 852654..853625 (+) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  I6K93_RS04255 (I6K93_04265) rpsO 853745..854014 (+) 270 WP_002439528.1 30S ribosomal protein S15 -
  I6K93_RS04260 (I6K93_04270) pnp 854146..856251 (+) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  I6K93_RS04265 (I6K93_04275) - 856619..858292 (+) 1674 WP_002457357.1 ribonuclease J -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33717.61 Da        Isoelectric Point: 9.3616

>NTDB_id=537511 I6K93_RS04135 WP_002484839.1 824677..825549(+) (dprA) [Staphylococcus epidermidis strain FDAARGOS_1363]
MIQQTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=537511 I6K93_RS04135 WP_002484839.1 824677..825549(+) (dprA) [Staphylococcus epidermidis strain FDAARGOS_1363]
TTGATACAACAGACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4Y7VXK4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

56.944

99.31

0.566

  dprA Staphylococcus aureus N315

56.944

99.31

0.566